DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13252 and Y8A9A.2

DIOPT Version :9

Sequence 1:NP_649248.3 Gene:CG13252 / 40289 FlyBaseID:FBgn0037016 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001364778.1 Gene:Y8A9A.2 / 173723 WormBaseID:WBGene00021171 Length:1358 Species:Caenorhabditis elegans


Alignment Length:314 Identity:64/314 - (20%)
Similarity:93/314 - (29%) Gaps:106/314 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 ELPNASEMASAADGVSYNRGLISDEDYVQC----CLNRKCVCKTCYIP--DC------------- 118
            :.|.|:...|.:..| |.|..:::.|...|    ...:.|....||.|  .|             
 Worm   573 DAPCATTCGSCSQQV-YRRVCLTEADCGACTGADVKIQNCNVGVCYFPLDSCCAGYTATVSGTLH 636

  Fly   119 ----------PSDADEDVVVVELV----PENNQTPGECCG--------TYECQAEPNCTVVRDTD 161
                      |:..||....::.:    .|.:...|..||        |..|.::..|:...|| 
 Worm   637 ICGPQPTTTTPAPNDETCCPLDGIWGAWGEWSVCTGTTCGNCGGSRTRTRVCASDSFCSCNGDT- 700

  Fly   162 FHWLKQCRRCKCESGLK--ICHKTCDERAEGVCQS--------KISGMFYKDGENWTENCKTCEC 216
                .:...|:..|...  ....||::.|.|.||:        |.:|.|.......|:.|....|
 Worm   701 ----TESENCRLLSSWSEWTTTGTCNQTACGTCQTLTYTRTCLKTNGCFCMGSATKTDYCSRKPC 761

  Fly   217 EKGEPKCTMSFCGNLNCPSEQQVMLKDTCCPVCWPKCAPMPHEKQDDGSYEDYVDESETPEEDSL 281
            ..|...|        |..:.|.|.....|.||                       |:...|.|  
 Worm   762 ATGTACC--------NSLTAQTVDGVSICGPV-----------------------EAAEDETD-- 793

  Fly   282 PPLLPDPLTTQQSAELV------------ATSTTTSSNGTTSTTVVPLAATVNC 323
                |.|.||...|..|            |.:.|..:.|.|:.:.|.|:...||
 Worm   794 ----PVPCTTTTPACCVLGGVWSEWSSGDACNDTCGNCGVTTLSRVCLSQDYNC 843

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13252NP_649248.3 VWC 197..249 CDD:302663 12/51 (24%)
Y8A9A.2NP_001364778.1 TSP1 1203..1252 CDD:214559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.