powered by:
Protein Alignment CG13252 and COCH
DIOPT Version :9
Sequence 1: | NP_649248.3 |
Gene: | CG13252 / 40289 |
FlyBaseID: | FBgn0037016 |
Length: | 384 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001334649.1 |
Gene: | COCH / 1690 |
HGNCID: | 2180 |
Length: | 615 |
Species: | Homo sapiens |
Alignment Length: | 69 |
Identity: | 17/69 - (24%) |
Similarity: | 25/69 - (36%) |
Gaps: | 14/69 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 60 NLLAVDLIKSNAVELPNASEMASAADGVSYNRGLIS--------DEDYV-----QCCLNRKCVC- 110
|:..|.:.|....||....::......|..|.|..| ...|| :.|.:.:.:|
Human 360 NVFIVSVAKPIPEELGMVQDVTFVDKAVCRNNGFFSYHMPNWFGTTKYVKPLVQKLCTHEQMMCS 424
Fly 111 KTCY 114
||||
Human 425 KTCY 428
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG13252 | NP_649248.3 |
VWC |
197..249 |
CDD:302663 |
|
COCH | NP_001334649.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1216 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.