DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13252 and Vwf

DIOPT Version :9

Sequence 1:NP_649248.3 Gene:CG13252 / 40289 FlyBaseID:FBgn0037016 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_446341.1 Gene:Vwf / 116669 RGDID:621759 Length:2812 Species:Rattus norvegicus


Alignment Length:316 Identity:68/316 - (21%)
Similarity:98/316 - (31%) Gaps:82/316 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 CQSVKCPPDAEMQCPADSSIRHNLLAVDLIKSNAVELPNASEMASAADGVSYNRGLISDEDYVQC 102
            |:..:....|::.||....:      .||:..|   ||..............|.|        :|
  Rat  2307 CEVARLKQSADLCCPEYECV------CDLVNCN---LPPVPPCEGGLQPTLTNPG--------EC 2354

  Fly   103 -----CLNRKCVCKTCYIPDCPSDADEDVVVVELVPENNQTP----GECCGTYECQAEPNCTVVR 158
                 |..||..||....|.||.               ::||    .:||..|||    .|:.|.
  Rat  2355 RPTFTCACRKEECKRVSPPSCPP---------------HRTPTLRKTQCCDEYEC----TCSCVN 2400

  Fly   159 DT---DFHWLKQC--RRCKCESGLKICHKTCDERAEGVCQSKISGMFYKDGENWTENCKTCECEK 218
            .|   ...:|...  ..|.|.:...:..|.|..|          |..|..|:.|.|.|.||.|..
  Rat  2401 STLSCPLGYLASATTNDCGCTTTTCLPDKVCVHR----------GTVYPVGQFWEEGCDTCTCTD 2455

  Fly   219 GE--------PKCTMSFCGNLNCPSEQQVMLKDTCCPVCWPKCAPMPHEKQDD--GSYEDYVDES 273
            .|        .:|:...|.:...|....|:.:..||..|.|....:....:.|  .|::....:.
  Rat  2456 MEDTVVGLRVAQCSQKPCEDSCQPGFSYVLHEGECCGKCLPSACKVAGSPRGDSLSSWKSVGSQW 2520

  Fly   274 ETPEEDSLPPLLPDPLTTQQSAELVATSTTTSSNGTTSTTVVPLAAT---VNCNNA 326
            ..||.    |.|.:.....:.|..|     ...|.:.....||...|   :||..:
  Rat  2521 AVPEN----PCLINECVRVEDAVFV-----QQRNISCPQLAVPTCPTGFQLNCETS 2567

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13252NP_649248.3 VWC 197..249 CDD:302663 16/59 (27%)
VwfNP_446341.1 VWD 35..179 CDD:278521
C8 218..292 CDD:214843
TIL 295..348 CDD:280072
VWD 377..540 CDD:214566
C8 580..648 CDD:285899
TIL 652..707 CDD:280072
VWD 856..1011 CDD:214566
C8 1053..1127 CDD:214843
TIL 1146..1196 CDD:280072
VWA_N2 1198..1276 CDD:292782
VWA 1277..1449 CDD:214621
VWA 1498..1658 CDD:278519
VWA 1691..1862 CDD:278519
VWD 1950..2102 CDD:278521
C8 2136..2199 CDD:285899
TIL 2203..2254 CDD:280072
VWC 2257..2321 CDD:214564 2/13 (15%)
VWC 2431..2494 CDD:214564 18/72 (25%)
VWC 2581..2643 CDD:302663
CT 2726..2807 CDD:214482
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.