DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cmpy and HTRA3

DIOPT Version :10

Sequence 1:NP_001097652.1 Gene:cmpy / 40288 FlyBaseID:FBgn0037015 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_444272.1 Gene:HTRA3 / 94031 HGNCID:30406 Length:453 Species:Homo sapiens


Alignment Length:166 Identity:48/166 - (28%)
Similarity:63/166 - (37%) Gaps:46/166 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 PKECDVIR--SPDCPGKGLMLWDPCKCCRICAKTLGESCGGPGGFSGQCEPPLQCVTKLPISSGL 155
            |..|||.|  ||.|||.  .:.|.|.||.:||.:.||.||||  ....|...|:||.        
Human    26 PARCDVSRCPSPRCPGG--YVPDLCNCCLVCAASEGEPCGGP--LDSPCGESLECVR-------- 78

  Fly   156 GVCMDLQHLTALTYSQHDNCSDSDSIVLEPGCEITNKRCQCWPTMRTCLSELTSDGGSPDDSRWH 220
            |:|               .|..|.::....|....|. |......|..| :|:   |:|      
Human    79 GLC---------------RCRWSHAVCGTDGHTYANV-CALQAASRRAL-QLS---GTP------ 117

  Fly   221 FKNLED--CQLNLQNLIKLEQEF----DEDYKISPS 250
            .:.|:.  |.|.|..|.....:|    |...||:|:
Human   118 VRQLQKGACPLGLHQLSSPRYKFNFIADVVEKIAPA 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cmpyNP_001097652.1 IGFBP 91..145 CDD:459717 24/53 (45%)
HTRA3NP_444272.1 IGFBP 25..76 CDD:459717 24/53 (45%)
KAZAL <89..126 CDD:197624 9/47 (19%)
DegQ 173..443 CDD:440035
Serine protease 175..340
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.