Sequence 1: | NP_001097652.1 | Gene: | cmpy / 40288 | FlyBaseID: | FBgn0037015 | Length: | 273 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_003873.1 | Gene: | CCN4 / 8840 | HGNCID: | 12769 | Length: | 367 | Species: | Homo sapiens |
Alignment Length: | 248 | Identity: | 46/248 - (18%) |
---|---|---|---|
Similarity: | 61/248 - (24%) | Gaps: | 132/248 - (53%) |
- Green bases have known domain annotations that are detailed below.
Fly 89 CYCNPKECDVIRSPDCPGKGLMLWDPCKCCRICAKTLGESCG----------------------- 130
Fly 131 --------GPG------------GFSGQCEPPLQCVTKLPISSGLG------------------- 156
Fly 157 ------------VCMD-----------------------LQHLTALTY-SQHDNCSDSDSIVLEP 185
Fly 186 GCEITNKRCQCWPTM--RTCLSELTSDGGSPDDSRWHFKNLEDCQLNLQNLIK 236 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
cmpy | NP_001097652.1 | IGFBP | 91..145 | CDD:395164 | 18/96 (19%) |
CCN4 | NP_003873.1 | IGFBP | 49..101 | CDD:365955 | 15/53 (28%) |
VWC | 123..181 | CDD:214564 | 5/62 (8%) | ||
TSP1 | 220..260 | CDD:214559 | 15/60 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X231 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |