DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cmpy and CCN4

DIOPT Version :9

Sequence 1:NP_001097652.1 Gene:cmpy / 40288 FlyBaseID:FBgn0037015 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_003873.1 Gene:CCN4 / 8840 HGNCID:12769 Length:367 Species:Homo sapiens


Alignment Length:248 Identity:46/248 - (18%)
Similarity:61/248 - (24%) Gaps:132/248 - (53%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 CYCNPKECDVIRSPDCPGKGLMLWDPCKCCRICAKTLGESCG----------------------- 130
            |.|.|.      .|.||....::.|.|:||::||:.||::|.                       
Human    53 CECPPS------PPRCPLGVSLITDGCECCKMCAQQLGDNCTEAAICDPHRGLYCDYSGDRPRYA 111

  Fly   131 --------GPG------------GFSGQCEPPLQCVTKLPISSGLG------------------- 156
                    |.|            .|...|:....|     |...:|                   
Human   112 IGVCAQVVGVGCVLDGVRYNNGQSFQPNCKYNCTC-----IDGAVGCTPLCLRVRPPRLWCPHPR 171

  Fly   157 ------------VCMD-----------------------LQHLTALTY-SQHDNCSDSDSIVLEP 185
                        ||.|                       ..|...:.| |....||.|..  |..
Human   172 RVSIPGHCCEQWVCEDDAKRPRKTAPRDTGAFDAVGEVEAWHRNCIAYTSPWSPCSTSCG--LGV 234

  Fly   186 GCEITNKRCQCWPTM--RTCLSELTSDGGSPDDSRWHFKNLEDCQLNLQNLIK 236
            ...|:|...||||..  |.|                   ||..|.:::..|||
Human   235 STRISNVNAQCWPEQESRLC-------------------NLRPCDVDIHTLIK 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cmpyNP_001097652.1 IGFBP 91..145 CDD:395164 18/96 (19%)
CCN4NP_003873.1 IGFBP 49..101 CDD:365955 15/53 (28%)
VWC 123..181 CDD:214564 5/62 (8%)
TSP1 220..260 CDD:214559 15/60 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X231
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.