DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cmpy and CCN6

DIOPT Version :9

Sequence 1:NP_001097652.1 Gene:cmpy / 40288 FlyBaseID:FBgn0037015 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_003871.1 Gene:CCN6 / 8838 HGNCID:12771 Length:354 Species:Homo sapiens


Alignment Length:229 Identity:51/229 - (22%)
Similarity:73/229 - (31%) Gaps:90/229 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 KCYCN-PKECDVIRSPDCPGKGLMLWDPCKCCRICAKTLGESCG------------------GPG 133
            |.:|: |.:|.. :.|.||....::.|.|.||:||||..||.|.                  .|.
Human    45 KQFCHWPCKCPQ-QKPRCPPGVSLVRDGCGCCKICAKQPGEICNEADLCDPHKGLYCDYSVDRPR 108

  Fly   134 GFSGQC-----------------------EPPLQCVTKLPISSGLGVCMDL-------QHLTAL- 167
            ..:|.|                       .|...|   |.:|..:| |..|       .|.:.. 
Human   109 YETGVCAYLVAVGCEFNQVHYHNGQVFQPNPLFSC---LCVSGAIG-CTPLFIPKLAGSHCSGAK 169

  Fly   168 --TYSQHDNCSDSDSIVLEPGCE-----------------ITNKRCQC----W-PTMRTC---LS 205
              ..|...|||      |||..:                 |..|:|..    | |..|||   :|
Human   170 GGKKSDQSNCS------LEPLLQQLSTSYKTMPAYRNLPLIWKKKCLVQATKWTPCSRTCGMGIS 228

  Fly   206 ELTSDGGSPDDSRWHFK--NLEDCQLNLQNLIKL 237
            ...::..|..:.|...:  .::.|..|:...||:
Human   229 NRVTNENSNCEMRKEKRLCYIQPCDSNILKTIKI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cmpyNP_001097652.1 IGFBP 91..145 CDD:395164 21/95 (22%)
CCN6NP_003871.1 IGFBP 48..100 CDD:365955 17/52 (33%)
GHB_like 275..341 CDD:389804
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X231
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.