DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cmpy and Esm1

DIOPT Version :9

Sequence 1:NP_001097652.1 Gene:cmpy / 40288 FlyBaseID:FBgn0037015 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_072126.1 Gene:Esm1 / 64536 RGDID:71013 Length:184 Species:Rattus norvegicus


Alignment Length:178 Identity:43/178 - (24%)
Similarity:68/178 - (38%) Gaps:40/178 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 VSALLIYLWCYLLLVMAASGGSNHVVNGLKCYCNPKECDVIRSPDCPG----KGLMLWDPCKCCR 119
            :.:||:.....:.|.:..:..:.:.|:     | |:.||   :.:|..    |..:| |.|.||:
  Rat     1 MKSLLLLTTLLIPLHLGMAWSAKYAVD-----C-PEHCD---NTECRSSLRCKRTVL-DDCGCCQ 55

  Fly   120 ICAKTLGESC----GGPGGFSGQCEPPLQC---VTKLPISSGLGVCMDLQHLT-ALTYSQHDNCS 176
            :||...||:|    .|..|.  :|.|.|:|   ..:.......|||.|..:.| .:...:..||.
  Rat    56 VCAAGPGETCYRTVSGMDGV--KCGPGLKCHFYSEEDDFGDEFGVCKDCPYGTFGMDCKETCNCQ 118

  Fly   177 DSDSIVLEPGCEITNKRCQCWP---------TMRTCLSELTSDGGSPD 215
            ...       |:....||..:|         ..||..|:...|..|.|
  Rat   119 SGI-------CDRVTGRCLDFPFFQYAAAKSPSRTSASQTERDAASGD 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cmpyNP_001097652.1 IGFBP 91..145 CDD:395164 21/61 (34%)
Esm1NP_072126.1 IGFBP 28..83 CDD:395164 21/61 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 145..184 6/15 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1508747at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.