powered by:
Protein Alignment cmpy and pcyox1
DIOPT Version :9
Sequence 1: | NP_001097652.1 |
Gene: | cmpy / 40288 |
FlyBaseID: | FBgn0037015 |
Length: | 273 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001016302.1 |
Gene: | pcyox1 / 549056 |
XenbaseID: | XB-GENE-1002891 |
Length: | 501 |
Species: | Xenopus tropicalis |
Alignment Length: | 43 |
Identity: | 12/43 - (27%) |
Similarity: | 20/43 - (46%) |
Gaps: | 5/43 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 200 MRTCLSELTSDGGSPDDSRWHFKN-----LEDCQLNLQNLIKL 237
|:|.:.||.....||.|:.....| .::.:..|.|:||:
Frog 94 MKTFVKELGLSPRSPSDNLVGIYNGEQFVFQESEWFLINIIKM 136
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X231 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.