Sequence 1: | NP_001097652.1 | Gene: | cmpy / 40288 | FlyBaseID: | FBgn0037015 | Length: | 273 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001015042.1 | Gene: | ccn2 / 548598 | XenbaseID: | XB-GENE-855547 | Length: | 343 | Species: | Xenopus tropicalis |
Alignment Length: | 294 | Identity: | 63/294 - (21%) |
---|---|---|---|
Similarity: | 92/294 - (31%) | Gaps: | 137/294 - (46%) |
- Green bases have known domain annotations that are detailed below.
Fly 59 VSALLIY-LWCYLLLVMAASGGSNHVVNGLKCYCNPK--ECDVIRSPDCPGKGLMLWDPCKCCRI 120
Fly 121 CAKTLGESC-------------------------------GGP---GG--------FSGQCEPPL 143
Fly 144 QCVTKLPISSGLGVCMDLQHLTALTYSQHDNCSDSDSIVLEPGC------EITNKRCQCW----P 198
Fly 199 TMRT-------------------------CLSELT-------------SDGGSPDDSRWHFKN-- 223
Fly 224 ----LEDCQLNLQNLIKLEQEFDEDYKIS-PSKF 252 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
cmpy | NP_001097652.1 | IGFBP | 91..145 | CDD:395164 | 24/97 (25%) |
ccn2 | NP_001015042.1 | IGFBP | 24..76 | CDD:365955 | 20/68 (29%) |
VWC | 97..156 | CDD:214564 | 16/78 (21%) | ||
TSP1 | 196..237 | CDD:214559 | 3/40 (8%) | ||
GHB_like | 247..339 | CDD:389804 | 6/16 (38%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X231 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |