DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cmpy and ccn2

DIOPT Version :9

Sequence 1:NP_001097652.1 Gene:cmpy / 40288 FlyBaseID:FBgn0037015 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001015042.1 Gene:ccn2 / 548598 XenbaseID:XB-GENE-855547 Length:343 Species:Xenopus tropicalis


Alignment Length:294 Identity:63/294 - (21%)
Similarity:92/294 - (31%) Gaps:137/294 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 VSALLIY-LWCYLLLVMAASGGSNHVVNGLKCYCNPK--ECDVIRSPDCPGKGLMLWDPCKCCRI 120
            |:|:|:: |:|::......:|         :|.|..|  .||       ||..| :.|.|.||::
 Frog     6 VTAVLLFALFCWVSDAQECNG---------ECQCPHKVPVCD-------PGVSL-VQDGCGCCKV 53

  Fly   121 CAKTLGESC-------------------------------GGP---GG--------FSGQCEPPL 143
            |||.|||.|                               |.|   ||        |...|:...
 Frog    54 CAKQLGELCTERDVCDPHKGLFCDFGSRVNRKIGVCTAREGAPCVFGGTVYRSGESFQSSCKYQC 118

  Fly   144 QCVTKLPISSGLGVCMDLQHLTALTYSQHDNCSDSDSIVLEPGC------EITNKRCQCW----P 198
            .|     |..|:| |:.|             || .|..:..|.|      ::..|.|:.|    |
 Frog   119 TC-----IDGGVG-CVPL-------------CS-MDIRLPSPECPFPRRVKLPGKCCEEWVCDQP 163

  Fly   199 TMRT-------------------------CLSELT-------------SDGGSPDDSRWHFKN-- 223
            ..||                         ||.:.|             |...:.|:.....:.  
 Frog   164 QERTLVGPALPAFRMEETYGPDPSLIRANCLVQTTEWSACSKTCGMGISTRVTNDNEHCRLEKQS 228

  Fly   224 ----LEDCQLNLQNLIKLEQEFDEDYKIS-PSKF 252
                :..|:.:|:..||..::.....||| |.||
 Frog   229 RLCMVRPCEADLEENIKKGKKCIRTPKISKPVKF 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cmpyNP_001097652.1 IGFBP 91..145 CDD:395164 24/97 (25%)
ccn2NP_001015042.1 IGFBP 24..76 CDD:365955 20/68 (29%)
VWC 97..156 CDD:214564 16/78 (21%)
TSP1 196..237 CDD:214559 3/40 (8%)
GHB_like 247..339 CDD:389804 6/16 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X231
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.