Sequence 1: | NP_001097652.1 | Gene: | cmpy / 40288 | FlyBaseID: | FBgn0037015 | Length: | 273 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011531200.1 | Gene: | CRIM1 / 51232 | HGNCID: | 2359 | Length: | 1077 | Species: | Homo sapiens |
Alignment Length: | 255 | Identity: | 66/255 - (25%) |
---|---|---|---|
Similarity: | 96/255 - (37%) | Gaps: | 95/255 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 30 RGLAGKQQHNNAKLPLRMRSNGSYFGRLNVSALLIYLWCYLLLVMAASGGSNHVVNGLKCY-CNP 93
Fly 94 KECDVIRSPDCPGKGLMLWDPCKCCRICAKTLGESCGGPGGFSGQCEPPLQCVTKLPISSG---- 154
Fly 155 --LGVCMDLQHLTALTYSQH------------------------------DNCSDSDSIVLEP-- 185
Fly 186 -----GCEITNKRCQCWPTMRTCLSELTSDGGSPDDSRWHFKNLEDCQLNLQNLIKLEQE 240 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
cmpy | NP_001097652.1 | IGFBP | 91..145 | CDD:395164 | 20/53 (38%) |
CRIM1 | XP_011531200.1 | IGFBP | 39..90 | CDD:278641 | 20/54 (37%) |
VWC | 377..431 | CDD:214564 | |||
VWC | 444..497 | CDD:214564 | |||
Antistasin | 608..633 | CDD:280912 | |||
VWC | 653..703 | CDD:302663 | |||
VWC | 724..775 | CDD:302663 | |||
VWC | 799..849 | CDD:214564 | |||
VWC | 860..914 | CDD:302663 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |