DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cmpy and CRIM1

DIOPT Version :9

Sequence 1:NP_001097652.1 Gene:cmpy / 40288 FlyBaseID:FBgn0037015 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_011531200.1 Gene:CRIM1 / 51232 HGNCID:2359 Length:1077 Species:Homo sapiens


Alignment Length:255 Identity:66/255 - (25%)
Similarity:96/255 - (37%) Gaps:95/255 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RGLAGKQQHNNAKLPLRMRSNGSYFGRLNVSALLIYLWCYLLLVMAASGGSNHVVNGLKCY-CNP 93
            |||||                   .|.|.||.|      .|||::|.||     ...|.|. |:.
Human     8 RGLAG-------------------CGHLLVSLL------GLLLLLARSG-----TRALVCLPCDE 42

  Fly    94 KECDVIRSPDCPGKGLMLWDPCKCCRICAKTLGESCGGPGGFSGQCEPPLQCVTKLPISSG---- 154
            .:|:..|  :|||.  ::...|.||..||....|||||..|..|.|:..|:||.:.|::..    
Human    43 SKCEEPR--NCPGS--IVQGVCGCCYTCASQRNESCGGTFGIYGTCDRGLRCVIRPPLNGDSLTE 103

  Fly   155 --LGVCMDLQHLTALTYSQH------------------------------DNCSDSDSIVLEP-- 185
              .||| ::..|....|.:|                              :|.:|...:..:|  
Human   104 YEAGVC-EVFSLNDKIYGKHGISDTPTAPRLPFLKKELEEPSDVSSYLEDENWTDDQLLGFKPCN 167

  Fly   186 -----GCEITNKRCQCWPTMRTCLSELTSDGGSPDDSRWHFKNLEDCQLNLQNLIKLEQE 240
                 ||.|.|.:|:| .|:|||            .:.:.|.:.:.|   |..|.::|:|
Human   168 ENLIAGCNIINGKCEC-NTIRTC------------SNPFEFPSQDMC---LSALKRIEEE 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cmpyNP_001097652.1 IGFBP 91..145 CDD:395164 20/53 (38%)
CRIM1XP_011531200.1 IGFBP 39..90 CDD:278641 20/54 (37%)
VWC 377..431 CDD:214564
VWC 444..497 CDD:214564
Antistasin 608..633 CDD:280912
VWC 653..703 CDD:302663
VWC 724..775 CDD:302663
VWC 799..849 CDD:214564
VWC 860..914 CDD:302663
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.