powered by:
Protein Alignment cmpy and Ccn6
DIOPT Version :9
Sequence 1: | NP_001097652.1 |
Gene: | cmpy / 40288 |
FlyBaseID: | FBgn0037015 |
Length: | 273 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001163954.1 |
Gene: | Ccn6 / 499461 |
RGDID: | 1564120 |
Length: | 354 |
Species: | Rattus norvegicus |
Alignment Length: | 53 |
Identity: | 18/53 - (33%) |
Similarity: | 25/53 - (47%) |
Gaps: | 10/53 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 89 CYCNPKECDVIRSPDCPGKGLMLWDPCKCCRICAKTLGESCGGPGGFSGQCEP 141
|.|.| :.|.||....::.|.|.||:||||..|:.|.. :..|:|
Rat 52 CRCPP------QVPTCPPGVSLVRDGCGCCKICAKQPGDICNE----AESCDP 94
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
cmpy | NP_001097652.1 |
IGFBP |
91..145 |
CDD:395164 |
17/51 (33%) |
Ccn6 | NP_001163954.1 |
IGFBP |
48..100 |
CDD:278641 |
18/53 (34%) |
GHB_like |
275..342 |
CDD:304424 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X231 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.