DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cmpy and Ccn6

DIOPT Version :9

Sequence 1:NP_001097652.1 Gene:cmpy / 40288 FlyBaseID:FBgn0037015 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001163954.1 Gene:Ccn6 / 499461 RGDID:1564120 Length:354 Species:Rattus norvegicus


Alignment Length:53 Identity:18/53 - (33%)
Similarity:25/53 - (47%) Gaps:10/53 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 CYCNPKECDVIRSPDCPGKGLMLWDPCKCCRICAKTLGESCGGPGGFSGQCEP 141
            |.|.|      :.|.||....::.|.|.||:||||..|:.|..    :..|:|
  Rat    52 CRCPP------QVPTCPPGVSLVRDGCGCCKICAKQPGDICNE----AESCDP 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cmpyNP_001097652.1 IGFBP 91..145 CDD:395164 17/51 (33%)
Ccn6NP_001163954.1 IGFBP 48..100 CDD:278641 18/53 (34%)
GHB_like 275..342 CDD:304424
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X231
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.