DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cmpy and ccn5

DIOPT Version :9

Sequence 1:NP_001097652.1 Gene:cmpy / 40288 FlyBaseID:FBgn0037015 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_031749917.1 Gene:ccn5 / 496678 XenbaseID:XB-GENE-876336 Length:314 Species:Xenopus tropicalis


Alignment Length:208 Identity:56/208 - (26%)
Similarity:82/208 - (39%) Gaps:57/208 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VVLEQDVRT-RSSQGERKRGLAGKQQHNNAKLPLRMRS----NGSYF----GRLNVSALLIYLWC 68
            |:|.:.:.| ....|.||    ||..|    :|...:|    ||:..    |.|| ..||:..:|
 Frog    27 VLLPESINTVLDGAGSRK----GKPHH----IPNSRQSAGLMNGACMAMDPGILN-RYLLLLGYC 82

  Fly    69 YLLLVMAASGGSNHVVNGLKCYCN--PKECDVIRSPDCPGKGLMLWDPCKCCRICAKTLGESCGG 131
            .|..:.|.       :....|:|:  |        |.||....::.|.|.||||||:.|||||  
 Frog    83 ILPQICAQ-------LCRTPCFCSWIP--------PRCPPGVPVIVDGCGCCRICARQLGESC-- 130

  Fly   132 PGGFSGQCEPPLQCVTKLPI-SSGLGVCMDLQHLTALTYS-----QHDNCSDSDSIVLEPGCEIT 190
              .....|:...:.:...|. |:|.|.|         .|:     ::|.....|..|.:|.|:. 
 Frog   131 --DHLYLCDESKELLCDYPTGSNGRGTC---------NYNYDGSCEYDGKEYKDGEVFQPNCKF- 183

  Fly   191 NKRCQCWPTMRTC 203
              :|:|.....||
 Frog   184 --QCKCIDGGITC 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cmpyNP_001097652.1 IGFBP 91..145 CDD:395164 19/55 (35%)
ccn5XP_031749917.1 IGFBP 88..138 CDD:395164 21/68 (31%)
VWC 164..223 CDD:214564 9/34 (26%)
TSP1_CCN 256..299 CDD:408805
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X231
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.