Sequence 1: | NP_001097652.1 | Gene: | cmpy / 40288 | FlyBaseID: | FBgn0037015 | Length: | 273 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_002505.1 | Gene: | CCN3 / 4856 | HGNCID: | 7885 | Length: | 357 | Species: | Homo sapiens |
Alignment Length: | 286 | Identity: | 61/286 - (21%) |
---|---|---|---|
Similarity: | 88/286 - (30%) | Gaps: | 114/286 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 63 LIYLWCYLLLVMAASGGSNHVVNGLKCYCNPKECDVIRSPDCPGKGLMLWDPCKCCRICAKTLGE 127
Fly 128 SCGGPGGFSGQCEP-----PLQCVTKLPISSGLGVCMDLQHLTALTYSQHDNC------------ 175
Fly 176 ---------------------SDSDSIVLEPGC------EITNKRCQCW---PTMRTCLSELTSD 210
Fly 211 GGSPD--------------------------------DSRWHFKNLEDCQLNLQNLIKL----EQ 239
Fly 240 EFDEDYKISPSKFTYKKLRRKRKSLK 265 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
cmpy | NP_001097652.1 | IGFBP | 91..145 | CDD:395164 | 18/58 (31%) |
CCN3 | NP_002505.1 | IB | 33..>95 | CDD:197525 | 21/77 (27%) |
VWC | 110..170 | CDD:214564 | 7/59 (12%) | ||
CT | 269..338 | CDD:214482 | 4/4 (100%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X231 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |