DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cmpy and CCN3

DIOPT Version :9

Sequence 1:NP_001097652.1 Gene:cmpy / 40288 FlyBaseID:FBgn0037015 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_002505.1 Gene:CCN3 / 4856 HGNCID:7885 Length:357 Species:Homo sapiens


Alignment Length:286 Identity:61/286 - (21%)
Similarity:88/286 - (30%) Gaps:114/286 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LIYLWCYLLLVMAASGGSNHVVNGLKCYCNPKECDVIRSPDCPGKGLMLWDPCKCCRICAKTLGE 127
            |.:|..:||..:||:........| :|...|..|       .||...:| |.|.||.:||:..||
Human    18 LTFLLLHLLGQVAATQRCPPQCPG-RCPATPPTC-------APGVRAVL-DGCSCCLVCARQRGE 73

  Fly   128 SCGGPGGFSGQCEP-----PLQCVTKLPISSGLGVCMDLQHLTALTYSQHDNC------------ 175
            ||       ...||     .|.|......|:..|:|         |..:.|||            
Human    74 SC-------SDLEPCDESSGLYCDRSADPSNQTGIC---------TAVEGDNCVFDGVIYRSGEK 122

  Fly   176 ---------------------SDSDSIVLEPGC------EITNKRCQCW---PTMRTCLSELTSD 210
                                 ...|.::.||.|      |:..:.|:.|   |.....|..||..
Human   123 FQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLA 187

  Fly   211 GGSPD--------------------------------DSRWHFKNLEDCQLNLQNLIKL----EQ 239
            ...|:                                .:|...:| ..|::..|..:.:    ||
Human   188 AYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRN-RQCEMLKQTRLCMVRPCEQ 251

  Fly   240 EFDEDYKISPSKFTYKKLRRKRKSLK 265
            |.::     |:....||..|.:||||
Human   252 EPEQ-----PTDKKGKKCLRTKKSLK 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cmpyNP_001097652.1 IGFBP 91..145 CDD:395164 18/58 (31%)
CCN3NP_002505.1 IB 33..>95 CDD:197525 21/77 (27%)
VWC 110..170 CDD:214564 7/59 (12%)
CT 269..338 CDD:214482 4/4 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X231
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.