DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cmpy and Crim1

DIOPT Version :9

Sequence 1:NP_001097652.1 Gene:cmpy / 40288 FlyBaseID:FBgn0037015 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001162574.1 Gene:Crim1 / 298744 RGDID:1308710 Length:1037 Species:Rattus norvegicus


Alignment Length:225 Identity:66/225 - (29%)
Similarity:94/225 - (41%) Gaps:76/225 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RGLAGKQQHNNAKLPLRMRSNGSYFGRLNVSALLIYLWCYLLLVMAASGGSNHVVNGLKCY-CNP 93
            |||||                   .|.|:||.|      .|||::|.||     ...|.|. |:.
  Rat     8 RGLAG-------------------CGHLSVSLL------GLLLLLARSG-----TRALVCLPCDE 42

  Fly    94 KECDVIRSPDCPGKGLMLWDPCKCCRICAKTLGESCGGPGGFSGQCEPPLQCVTKLPISSG---- 154
            .:|:..||  |||.  ::...|.||.:||:...|||||..|..|.|:..|:||.:.|::..    
  Rat    43 SKCEEPRS--CPGS--IVQGVCGCCYMCARQRNESCGGAYGLHGACDRGLRCVIRPPLNGDSITE 103

  Fly   155 --LGVCMDLQHLTALTYSQHDNCSDSDSIVLEP-------GCEITNKRCQCWPTMRTCLSELTSD 210
              :|||.|            ::..|...:..||       ||.|.|.||:| .|:|||       
  Rat   104 YEVGVCED------------EDWDDDQLLGFEPCNENLISGCNIINGRCEC-STIRTC------- 148

  Fly   211 GGSPDDSRWHFKNLEDCQLNLQNLIKLEQE 240
                 ::.:.|...:.|   |..|.::|:|
  Rat   149 -----NNPFEFPRKDMC---LSALKRIEEE 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cmpyNP_001097652.1 IGFBP 91..145 CDD:395164 21/53 (40%)
Crim1NP_001162574.1 IB 37..>95 CDD:197525 24/61 (39%)
VWC 336..390 CDD:214564
VWC 403..456 CDD:214564
Antistasin 567..592 CDD:280912
VWC 612..662 CDD:302663
VWC 683..734 CDD:302663
VWC 758..808 CDD:302663
VWC 819..873 CDD:302663
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.