DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cmpy and Ccn5

DIOPT Version :9

Sequence 1:NP_001097652.1 Gene:cmpy / 40288 FlyBaseID:FBgn0037015 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_058569.2 Gene:Ccn5 / 22403 MGIID:1328326 Length:251 Species:Mus musculus


Alignment Length:179 Identity:48/179 - (26%)
Similarity:65/179 - (36%) Gaps:50/179 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 VSALLIYLWCYLLLVMAASGGSNHVVNGLKCYC--NPKECDVIRSPDCPGKGLMLWDPCKCCRIC 121
            :..|.|...|.|.:|.|.       :....|.|  .|.:|.       ||..|:| |.|.|||:|
Mouse     7 IHLLAISFLCILSMVYAQ-------LCPAPCACPWTPPQCP-------PGVPLVL-DGCGCCRVC 56

  Fly   122 AKTLGESCGGPGGFSGQCEPP--LQCVTKLPISSGLGVCMDLQHLTALTYSQHD-NCSDS----- 178
            |:.|||||    .....|:|.  |.|......|....||:         :.:.| :|..:     
Mouse    57 ARRLGESC----DHLHVCDPSQGLVCQPGAGPSGRGAVCL---------FEEDDGSCEVNGRRYL 108

  Fly   179 DSIVLEPGCEITNKRCQCWPTMRTCLSELTSDGGSPDDSRWHFKNLEDC 227
            |....:|.|.:.   |:|.....|||...:.|...|.   |      ||
Mouse   109 DGETFKPNCRVL---CRCDDGGFTCLPLCSEDVRLPS---W------DC 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cmpyNP_001097652.1 IGFBP 91..145 CDD:395164 22/57 (39%)
Ccn5NP_058569.2 IGFBP 26..78 CDD:278641 23/63 (37%)
VWC 100..159 CDD:214564 14/58 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X231
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.