Sequence 1: | NP_001097652.1 | Gene: | cmpy / 40288 | FlyBaseID: | FBgn0037015 | Length: | 273 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_061353.1 | Gene: | Ccn4 / 22402 | MGIID: | 1197008 | Length: | 367 | Species: | Mus musculus |
Alignment Length: | 236 | Identity: | 48/236 - (20%) |
---|---|---|---|
Similarity: | 74/236 - (31%) | Gaps: | 104/236 - (44%) |
- Green bases have known domain annotations that are detailed below.
Fly 90 YCN-PKECDVIRSPDCPGKGLMLWDPCKCCRICAKTLGESCGGPGGFSGQCEP--PLQCVTKLPI 151
Fly 152 SSG------LGVCMDLQH----LTALTYSQHD--------NCSDSDSIVLEPGC----------- 187
Fly 188 ---------EITNKRCQCW-----------------------------------------PTMRT 202
Fly 203 C-------LSELTSDGGSPDDSRWHFKNLEDCQLNLQNLIK 236 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
cmpy | NP_001097652.1 | IGFBP | 91..145 | CDD:395164 | 20/56 (36%) |
Ccn4 | NP_061353.1 | IGFBP | 49..101 | CDD:278641 | 20/56 (36%) |
VWC | 123..181 | CDD:214564 | 8/60 (13%) | ||
TSP_1 | 220..259 | CDD:301595 | 8/40 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X231 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |