DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cmpy and CCN2

DIOPT Version :9

Sequence 1:NP_001097652.1 Gene:cmpy / 40288 FlyBaseID:FBgn0037015 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001892.2 Gene:CCN2 / 1490 HGNCID:2500 Length:349 Species:Homo sapiens


Alignment Length:250 Identity:56/250 - (22%)
Similarity:80/250 - (32%) Gaps:90/250 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 GLKCYCNPKECDVIRSPDCPGKGLMLWDPCKCCRICAKTLGESCGGPGGFSGQCEP--PLQCVTK 148
            |..| ..|..|....:|.||....::.|.|.|||:|||.|||.|..    ...|:|  .|.|...
Human    26 GQNC-SGPCRCPDEPAPRCPAGVSLVLDGCGCCRVCAKQLGELCTE----RDPCDPHKGLFCHFG 85

  Fly   149 LPISSGLGVCMDLQHLTAL----TYSQHDN----------CSDS----------DSIVLEPGC-- 187
            .|.:..:|||........:    .|...::          |.|.          |..:..|.|  
Human    86 SPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSCKYQCTCLDGAVGCMPLCSMDVRLPSPDCPF 150

  Fly   188 ----EITNKRCQCW---------------------------PTM----------------RTC-- 203
                ::..|.|:.|                           |||                :||  
Human   151 PRRVKLPGKCCEEWVCDEPKDQTVVGPALAAYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGM 215

  Fly   204 --LSELTSDGGS---PDDSRWHFKNLEDCQLNLQNLIKLEQEFDEDYKIS-PSKF 252
              .:.:|:|..|   ...||  ...:..|:.:|:..||..::.....||| |.||
Human   216 GISTRVTNDNASCRLEKQSR--LCMVRPCEADLEENIKKGKKCIRTPKISKPIKF 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cmpyNP_001097652.1 IGFBP 91..145 CDD:395164 20/55 (36%)
CCN2NP_001892.2 IGFBP 29..82 CDD:395164 21/57 (37%)
VWC 103..163 CDD:278520 8/59 (14%)
TSP1_CCN 199..242 CDD:408805 7/44 (16%)
Heparin-binding. /evidence=ECO:0000269|PubMed:12553878 247..349 7/21 (33%)
GHB_like 253..345 CDD:419725 5/15 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X231
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.