Sequence 1: | NP_001097652.1 | Gene: | cmpy / 40288 | FlyBaseID: | FBgn0037015 | Length: | 273 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001892.2 | Gene: | CCN2 / 1490 | HGNCID: | 2500 | Length: | 349 | Species: | Homo sapiens |
Alignment Length: | 250 | Identity: | 56/250 - (22%) |
---|---|---|---|
Similarity: | 80/250 - (32%) | Gaps: | 90/250 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 86 GLKCYCNPKECDVIRSPDCPGKGLMLWDPCKCCRICAKTLGESCGGPGGFSGQCEP--PLQCVTK 148
Fly 149 LPISSGLGVCMDLQHLTAL----TYSQHDN----------CSDS----------DSIVLEPGC-- 187
Fly 188 ----EITNKRCQCW---------------------------PTM----------------RTC-- 203
Fly 204 --LSELTSDGGS---PDDSRWHFKNLEDCQLNLQNLIKLEQEFDEDYKIS-PSKF 252 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
cmpy | NP_001097652.1 | IGFBP | 91..145 | CDD:395164 | 20/55 (36%) |
CCN2 | NP_001892.2 | IGFBP | 29..82 | CDD:395164 | 21/57 (37%) |
VWC | 103..163 | CDD:278520 | 8/59 (14%) | ||
TSP1_CCN | 199..242 | CDD:408805 | 7/44 (16%) | ||
Heparin-binding. /evidence=ECO:0000269|PubMed:12553878 | 247..349 | 7/21 (33%) | |||
GHB_like | 253..345 | CDD:419725 | 5/15 (33%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X231 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |