DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cmpy and Ccn2

DIOPT Version :9

Sequence 1:NP_001097652.1 Gene:cmpy / 40288 FlyBaseID:FBgn0037015 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_034347.2 Gene:Ccn2 / 14219 MGIID:95537 Length:348 Species:Mus musculus


Alignment Length:66 Identity:24/66 - (36%)
Similarity:32/66 - (48%) Gaps:6/66 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 ECDVIRSPDCPGKGLMLWDPCKCCRICAKTLGESCGGPGGFSGQCEP--PLQCVTKLPISSGLGV 157
            :|....:|.||....::.|.|.|||:|||.|||.|..    ...|:|  .|.|....|.:..:||
Mouse    33 QCAAEAAPHCPAGVSLVLDGCGCCRVCAKQLGELCTE----RDPCDPHKGLFCDFGSPANRKIGV 93

  Fly   158 C 158
            |
Mouse    94 C 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cmpyNP_001097652.1 IGFBP 91..145 CDD:395164 19/51 (37%)
Ccn2NP_034347.2 IGFBP <40..81 CDD:365955 18/44 (41%)
VWC 102..161 CDD:214564
TSP1 201..242 CDD:214559
Heparin-binding. /evidence=ECO:0000250|UniProtKB:P29279 246..348
GHB_like 252..344 CDD:389804
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X231
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.