powered by:
Protein Alignment cmpy and Ccn2
DIOPT Version :9
Sequence 1: | NP_001097652.1 |
Gene: | cmpy / 40288 |
FlyBaseID: | FBgn0037015 |
Length: | 273 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_034347.2 |
Gene: | Ccn2 / 14219 |
MGIID: | 95537 |
Length: | 348 |
Species: | Mus musculus |
Alignment Length: | 66 |
Identity: | 24/66 - (36%) |
Similarity: | 32/66 - (48%) |
Gaps: | 6/66 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 95 ECDVIRSPDCPGKGLMLWDPCKCCRICAKTLGESCGGPGGFSGQCEP--PLQCVTKLPISSGLGV 157
:|....:|.||....::.|.|.|||:|||.|||.|.. ...|:| .|.|....|.:..:||
Mouse 33 QCAAEAAPHCPAGVSLVLDGCGCCRVCAKQLGELCTE----RDPCDPHKGLFCDFGSPANRKIGV 93
Fly 158 C 158
|
Mouse 94 C 94
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X231 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.