DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cmpy and ESM1

DIOPT Version :9

Sequence 1:NP_001097652.1 Gene:cmpy / 40288 FlyBaseID:FBgn0037015 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_008967.1 Gene:ESM1 / 11082 HGNCID:3466 Length:184 Species:Homo sapiens


Alignment Length:186 Identity:47/186 - (25%)
Similarity:70/186 - (37%) Gaps:64/186 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 LLV---MAASGGSNHVVNGLKC--YCNPKECDVIRSPDCPGKGLMLWDPCKCCRICAKTLGESC- 129
            |||   :.|:..:|:.|:   |  :|:..||.  .||.|  |..:| |.|.|||:||...||:| 
Human    10 LLVPAHLVAAWSNNYAVD---CPQHCDSSECK--SSPRC--KRTVL-DDCGCCRVCAAGRGETCY 66

  Fly   130 ---GGPGGFSGQCEPPLQCVT---KLPISSGLGVCMDLQHLT----------------------- 165
               .|..|.  :|.|.|:|..   :.|.....|:|.|..:.|                       
Human    67 RTVSGMDGM--KCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKC 129

  Fly   166 ----------------ALTYSQHDNCSDSDSIVLEPGCEITNKRCQCWPTMRTCLS 205
                            .::.::||..|...:||.|   |:..:.....|.||..|:
Human   130 LKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVRE---EVVKENAAGSPVMRKWLN 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cmpyNP_001097652.1 IGFBP 91..145 CDD:395164 23/57 (40%)
ESM1NP_008967.1 IB 26..100 CDD:197525 28/83 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1508747at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.