DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kni and RORA

DIOPT Version :9

Sequence 1:NP_001287130.1 Gene:kni / 40287 FlyBaseID:FBgn0001320 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_599022.1 Gene:RORA / 6095 HGNCID:10258 Length:556 Species:Homo sapiens


Alignment Length:138 Identity:48/138 - (34%)
Similarity:73/138 - (52%) Gaps:14/138 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNISTISECKNEGKCIIDKKNRTTCKACRLRKCYNV 74
            ||:||:.::|.|:|..||||||.||.||..:.:|.| |..:..|:||:.:|..|:.|||:||..|
Human   106 CKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYS-CPRQKNCLIDRTSRNRCQHCRLQKCLAV 169

  Fly    75 GMSKGGSRYGRRSN------WFKI--HCLLQEHEQAAAAAGKAPPLAG--GVSVGGAPSASSPVG 129
            |||:...::||.|.      :.::  |.:.|:........|:|.||..  .:|..|.......:.
Human   170 GMSRDAVKFGRMSKKQRDSLYAEVQKHRMQQQQRDHQQQPGEAEPLTPTYNISANGLTELHDDLS 234

  Fly   130 S---PHTP 134
            :   .|||
Human   235 NYIDGHTP 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kniNP_001287130.1 NR_DBD_like 8..92 CDD:295381 37/87 (43%)
RORANP_599022.1 NR_DBD_ROR 99..193 CDD:143526 37/87 (43%)
NR_LBD_ROR_like 305..544 CDD:132737
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5442
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.