DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kni and Ar

DIOPT Version :10

Sequence 1:NP_001287130.1 Gene:kni / 40287 FlyBaseID:FBgn0001320 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_036634.2 Gene:Ar / 24208 RGDID:2147 Length:902 Species:Rattus norvegicus


Alignment Length:136 Identity:45/136 - (33%)
Similarity:57/136 - (41%) Gaps:32/136 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QTCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNISTISECKNEGKCIIDKKNRTTCKACRLRKCY 72
            :||.:||:.|:|.|:||.||..||.||.|:........ |.:...|.|||..|..|.:|||||||
  Rat   540 KTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYL-CASRNDCTIDKFRRKNCPSCRLRKCY 603

  Fly    73 NVGMSKGGSRYGRRSNWFKIHCLLQEHEQAAAAAGKAPPLAGGVSVGGAPSASSPVGSP------ 131
            ..||:.|..:..:..|     ..|||.                   |...||.||...|      
  Rat   604 EAGMTLGARKLKKLGN-----LKLQEE-------------------GENSSAGSPTEDPSQKMTV 644

  Fly   132 -HTPGF 136
             |..|:
  Rat   645 SHIEGY 650

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kniNP_001287130.1 NR_DBD_like 8..92 CDD:413390 34/83 (41%)
ArNP_036634.2 Interaction with ZNF318. /evidence=ECO:0000250|UniProtKB:P19091 1..569 15/28 (54%)
Modulating 1..540 45/136 (33%)
Androgen_recep 6..443 CDD:426632
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 35..146
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..224
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 439..465
Interaction with LPXN. /evidence=ECO:0000250|UniProtKB:P10275 534..901 45/136 (33%)
NR_DBD_AR 537..618 CDD:143547 33/78 (42%)
Interaction with HIPK3. /evidence=ECO:0000269|PubMed:9725910 554..644 36/114 (32%)
Interaction with CCAR1. /evidence=ECO:0000250|UniProtKB:P10275 574..901 29/102 (28%)
Interaction with KAT7. /evidence=ECO:0000250|UniProtKB:P10275 607..901 14/68 (21%)
NR_LBD_AR 655..900 CDD:132758
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.