DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kni and nhr-17

DIOPT Version :10

Sequence 1:NP_001287130.1 Gene:kni / 40287 FlyBaseID:FBgn0001320 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_510115.1 Gene:nhr-17 / 191719 WormBaseID:WBGene00003616 Length:396 Species:Caenorhabditis elegans


Alignment Length:88 Identity:38/88 - (43%)
Similarity:49/88 - (55%) Gaps:1/88 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QTCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNISTISECKNEGKCIIDKKNRTTCKACRLRKCY 72
            :.|.|||:.|:|.|:....|.|||:||.|......|.| |||.|.|||||..|.:|:.||.:||.
 Worm    29 ELCSVCGDVASGIHYSVAACNGCKTFFRRVVLENRTYS-CKNNGDCIIDKSMRCSCRHCRYKKCI 92

  Fly    73 NVGMSKGGSRYGRRSNWFKIHCL 95
            ..||.:|.....||....|::.|
 Worm    93 IAGMDRGELSMERRRKRKKLNGL 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kniNP_001287130.1 NR_DBD_like 8..92 CDD:413390 36/83 (43%)
nhr-17NP_510115.1 NR_DBD_HNF4A 31..105 CDD:143518 34/74 (46%)
NR_LBD 182..360 CDD:132726
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.