DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kni and nhr-206

DIOPT Version :9

Sequence 1:NP_001287130.1 Gene:kni / 40287 FlyBaseID:FBgn0001320 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_506033.1 Gene:nhr-206 / 187660 WormBaseID:WBGene00011097 Length:410 Species:Caenorhabditis elegans


Alignment Length:88 Identity:33/88 - (37%)
Similarity:46/88 - (52%) Gaps:12/88 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NLMNQTCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNISTISECKNEGKCII--DKKNRTTCKAC 66
            |::.:.|:|||.||.|:|:...||.|||:||.|:......:. |:....|::  :.|||..|..|
 Worm    37 NVLPEKCEVCGNPAVGYHYDVATCNGCKAFFRRTVITGRRVI-CRRRKNCLVEMEPKNRRICPGC 100

  Fly    67 RLRKCYNVGM---------SKGG 80
            |..||..|||         |.||
 Worm   101 RFSKCEEVGMNPRAIRAEISSGG 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kniNP_001287130.1 NR_DBD_like 8..92 CDD:295381 32/84 (38%)
nhr-206NP_506033.1 ZnF_C4 42..112 CDD:197701 29/70 (41%)
Glyco_hydro_30 <128..229 CDD:304972
HOLI 216..376 CDD:214658
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.