DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kni and nhr-177

DIOPT Version :9

Sequence 1:NP_001287130.1 Gene:kni / 40287 FlyBaseID:FBgn0001320 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_503455.1 Gene:nhr-177 / 184557 WormBaseID:WBGene00017503 Length:421 Species:Caenorhabditis elegans


Alignment Length:77 Identity:28/77 - (36%)
Similarity:44/77 - (57%) Gaps:1/77 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNISTISECK-NEGKCIIDKKNRTTCKACRLRKCYN 73
            |::|.|...|:|||.|:|..|.:||.|.:........|: ::|||..:|..:..||.|||.:|:.
 Worm    34 CRICFEKGHGYHFGVFSCRACAAFFRRCHFLKENRRRCRLSKGKCGPNKNGKWFCKTCRLERCFR 98

  Fly    74 VGMSKGGSRYGR 85
            :||:....:|.|
 Worm    99 LGMTPSNIQYDR 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kniNP_001287130.1 NR_DBD_like 8..92 CDD:295381 28/77 (36%)
nhr-177NP_503455.1 ZnF_C4 34..104 CDD:197701 26/69 (38%)
Hormone_recep 201..404 CDD:365875
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1136195at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.