powered by:
Protein Alignment kni and nhr-54
DIOPT Version :9
Sequence 1: | NP_001287130.1 |
Gene: | kni / 40287 |
FlyBaseID: | FBgn0001320 |
Length: | 434 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_507179.3 |
Gene: | nhr-54 / 180106 |
WormBaseID: | WBGene00003644 |
Length: | 422 |
Species: | Caenorhabditis elegans |
Alignment Length: | 71 |
Identity: | 26/71 - (36%) |
Similarity: | 39/71 - (54%) |
Gaps: | 4/71 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 CKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNISTISEC-KNEGKCII--DKKNRTTCKACRLRKC 71
|.:|.:...|.|||..||..|.:||.|:. .::...:| :..|||.| |:.....||.||.:||
Worm 17 CAICYKAGHGQHFGVETCRACAAFFRRTV-VLNRKYKCTRKSGKCKIGSDETKDVMCKFCRFKKC 80
Fly 72 YNVGMS 77
.::||:
Worm 81 IDLGMT 86
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1136195at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.