DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kni and nhr-59

DIOPT Version :9

Sequence 1:NP_001287130.1 Gene:kni / 40287 FlyBaseID:FBgn0001320 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_503624.2 Gene:nhr-59 / 178707 WormBaseID:WBGene00003649 Length:416 Species:Caenorhabditis elegans


Alignment Length:172 Identity:50/172 - (29%)
Similarity:76/172 - (44%) Gaps:43/172 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LMNQT-CKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNISTISECKN-EGKCIIDKKNRTTCKACR 67
            ::||| |:|||:.:.|.||||.||..|.:||.|.....:...:||: .|:|.|....|:.||.||
 Worm    14 VVNQTFCQVCGQESHGAHFGAITCRACAAFFRRVAAGANFEVKCKDGRGRCKILTNGRSCCKKCR 78

  Fly    68 LRKCYNVGMSKGGSRYGRRSNWFKIHCLLQEHEQAAAAAGKAPPLAGGVSVGGAPSASSPVGSPH 132
            |:||.::||.....::.|.|                        .|....|  |||.|:.:|.|.
 Worm    79 LKKCKDIGMDIQNFQFNRDS------------------------FATSTKV--APSLSTFLGRPE 117

  Fly   133 -----TPG---------FGDMAAHLHHHHQ-QQQQQQVPRHP 159
                 :||         |.|::..:.:..| ....:::|..|
 Worm   118 FLLSCSPGTSASTSQNKFIDLSPFIKNCKQVLMDDRKIPLAP 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kniNP_001287130.1 NR_DBD_like 8..92 CDD:295381 34/85 (40%)
nhr-59NP_503624.2 ZnF_C4 20..>71 CDD:197701 20/50 (40%)
Hormone_recep 182..392 CDD:278530
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1136195at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.