DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kni and Esr2

DIOPT Version :10

Sequence 1:NP_001287130.1 Gene:kni / 40287 FlyBaseID:FBgn0001320 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_997590.1 Gene:Esr2 / 13983 MGIID:109392 Length:567 Species:Mus musculus


Alignment Length:113 Identity:48/113 - (42%)
Similarity:64/113 - (56%) Gaps:20/113 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CKVCGEPAAGFHFGAFTCEGCKSFFGRS---YNNISTISECKNEGKCIIDKKNRTTCKACRLRKC 71
            |.||.:.|:|:|:|.::|||||:||.||   :|:..    |....:|.|||..|.:|:|||||||
Mouse   168 CAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYI----CPATNQCTIDKNRRKSCQACRLRKC 228

  Fly    72 YNVGMSKGGSRYGR---------RSNWFKIHCLLQEHEQAAAAAGKAP 110
            |.|||.|.|||..|         ||...::|||    .:|...:|..|
Mouse   229 YEVGMVKCGSRRERCGYRIVRRQRSASEQVHCL----NKAKRTSGHTP 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kniNP_001287130.1 NR_DBD_like 8..92 CDD:413390 42/93 (45%)
Esr2NP_997590.1 ERbeta_N 31..144 CDD:463610
NR_DBD_ER 163..244 CDD:143545 40/79 (51%)
NR_LBD_ER 282..535 CDD:132747
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.