DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment knrl and nhr-36

DIOPT Version :9

Sequence 1:NP_001303368.1 Gene:knrl / 40285 FlyBaseID:FBgn0001323 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_001294717.2 Gene:nhr-36 / 24104398 WormBaseID:WBGene00017198 Length:435 Species:Caenorhabditis elegans


Alignment Length:233 Identity:56/233 - (24%)
Similarity:92/233 - (39%) Gaps:60/233 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NQTCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLSSISDCKNNGECI--INKKNR-TACKACRL 72
            |:.|:|||:.:||.|:....|.||||||.|:..:.::..:||.:..|.  |::..| ..|:.|||
 Worm    33 NEMCRVCGKNSAGKHYSVPACHGCKSFFRRAIIHKTAYPECKYDKMCFSKISRITRPRKCRYCRL 97

  Fly    73 KKCLMVGMSKSGSRYGRRSNWFKIHCLLQEQQQQAVAAMAAHHNSQQAGGGSSGGSGGGQGMP-- 135
            :||..|||                           ||.:|.|.....:...||........:|  
 Worm    98 QKCYEVGM---------------------------VAIVAMHRKHDDSPLRSSDSELPDLPLPSP 135

  Fly   136 -----NGVKGM------SGVPPPAAAAAALGMLGHPG-----GYPGLYAVANAGGS--------- 175
                 |.|.|:      ..:.......:|...|..|.     ..||..|:|:..|:         
 Worm   136 IATRENYVSGIIDKLHSLDIQTDKFRKSAYNPLFIPNLEGILASPGKLALADKYGAMPGWPLTQE 200

  Fly   176 SRSKEELMMLGLDGSV---EYGSHKHPVVASPSVSSPD 210
            |.::::::|..::|.|   ...|...|...:|.:::.|
 Worm   201 SFNEQQILMNQVNGDVLTDSSSSFVLPTADTPGINTKD 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
knrlNP_001303368.1 NR_DBD_like 12..96 CDD:295381 29/86 (34%)
nhr-36NP_001294717.2 ZnF_C4 36..105 CDD:197701 27/68 (40%)
HOLI 242..400 CDD:214658
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.