DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment knrl and nhr-127

DIOPT Version :9

Sequence 1:NP_001303368.1 Gene:knrl / 40285 FlyBaseID:FBgn0001323 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_001370055.1 Gene:nhr-127 / 188480 WormBaseID:WBGene00003717 Length:355 Species:Caenorhabditis elegans


Alignment Length:69 Identity:27/69 - (39%)
Similarity:37/69 - (53%) Gaps:4/69 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 CKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLSSIS-DCKNNGE-CIINKKNRTACKACRLKKCL 76
            |:||...:.|:||...:|..|.|||.||.  :|.|. .||:..: |.|...:|..|:.||..||:
 Worm    13 CEVCKNQSNGYHFEVLSCGACASFFRRSV--VSKIKYQCKDGKKRCQIRYLDRHFCRYCRFSKCV 75

  Fly    77 MVGM 80
            ..||
 Worm    76 KAGM 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
knrlNP_001303368.1 NR_DBD_like 12..96 CDD:295381 27/69 (39%)
nhr-127NP_001370055.1 ZnF_C4 12..82 CDD:197701 27/69 (39%)
Hormone_recep 156..352 CDD:395054
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1136195at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.