DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment knrl and nhr-207

DIOPT Version :9

Sequence 1:NP_001303368.1 Gene:knrl / 40285 FlyBaseID:FBgn0001323 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_506035.1 Gene:nhr-207 / 187661 WormBaseID:WBGene00011098 Length:406 Species:Caenorhabditis elegans


Alignment Length:103 Identity:30/103 - (29%)
Similarity:53/103 - (51%) Gaps:9/103 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 CKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLSSISDCKNNGECI----INKKNRTACKACRLKK 74
            |::|..||.|:|:...:|.|||:||.|:... ..:.:||...:|:    |.|.....|.:||..|
 Worm    36 CRICRNPAVGYHYDVASCNGCKAFFRRTVIT-GRLPNCKFGDKCLEDHKIPKPGTRLCGSCRFSK 99

  Fly    75 CLMVGMSKSGSR---YGRRSNWFKIHCLLQEQQQQAVA 109
            |..:||:....:   ..::.|..|:. |:::..:|.:|
 Worm   100 CEQMGMNPMAIKSEIISKKGNILKME-LVKKHNRQLIA 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
knrlNP_001303368.1 NR_DBD_like 12..96 CDD:295381 26/88 (30%)
nhr-207NP_506035.1 ZnF_C4 36..107 CDD:197701 25/71 (35%)
HOLI 212..374 CDD:214658
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AR2M
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.