DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment knrl and nhr-179

DIOPT Version :9

Sequence 1:NP_001303368.1 Gene:knrl / 40285 FlyBaseID:FBgn0001323 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_001256000.1 Gene:nhr-179 / 184562 WormBaseID:WBGene00017512 Length:440 Species:Caenorhabditis elegans


Alignment Length:84 Identity:36/84 - (42%)
Similarity:52/84 - (61%) Gaps:1/84 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MNQTCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLSSISDCK-NNGECIINKKNRTACKACRLK 73
            :::.|:||.:|..|||||||||..|.:||.|::.:|.:...|: :||.|:..|..|..||.|||.
 Worm    27 IHEKCRVCDQPGHGFHFGAFTCRACSAFFRRAHFSLVTERKCRLSNGRCVPTKGGRWFCKKCRLA 91

  Fly    74 KCLMVGMSKSGSRYGRRSN 92
            ||...||:....:|.|.:|
 Worm    92 KCSEAGMNSRNIQYDRDAN 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
knrlNP_001303368.1 NR_DBD_like 12..96 CDD:295381 36/82 (44%)
nhr-179NP_001256000.1 ZnF_C4 30..99 CDD:197701 32/68 (47%)
HOLI 227..399 CDD:214658
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1136195at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.