DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13250 and CG34260

DIOPT Version :9

Sequence 1:NP_649245.1 Gene:CG13250 / 40284 FlyBaseID:FBgn0037013 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001262120.1 Gene:CG34260 / 5740551 FlyBaseID:FBgn0085289 Length:178 Species:Drosophila melanogaster


Alignment Length:185 Identity:39/185 - (21%)
Similarity:74/185 - (40%) Gaps:30/185 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LVVPILWQPSLATRDFDIRWRDINCSVIDPTTAEIFKCDIVEMPKKQGNFLNTFLLLRRSVTKMW 80
            :.:|:  |..||..::||..:.:.|.:|........:|                ||:|:....:.
  Fly    10 IFLPL--QLGLAKNNYDIAIKTLGCQIIAKAYVNSLEC----------------LLVRQRTAVVA 56

  Fly    81 VELSVGQIAN-----------RKDRPVQQLFKIRVDGCHLIEFRSKSRILNAVLHKLLQSGNYPD 134
            |:.|:.|...           :||:....:..|::|||..:....::.|:..:..:|....|.||
  Fly    57 VKFSLNQTIEHFDVLATFDLIKKDKSRMNIADIKIDGCKYLGSMYQNNIVGKLFKRLKSVSNLPD 121

  Fly   135 ACPLLANVNYTSTRFALNPDHFPAYMPDMKFNTKLVFQLSRNMGLIRASVDAEVM 189
            :||:.....|....:....|.||...|..|:..:|.. |.|:..:...|::..|:
  Fly   122 SCPVSKGKLYEIRNYTFISDEFPPGAPQAKWQVRLKL-LKRSELVADISIEGAVV 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13250NP_649245.1 DM8 95..181 CDD:214778 20/85 (24%)
CG34260NP_001262120.1 DUF1091 73..154 CDD:284008 19/80 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FA0X
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.