DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13250 and CG14518

DIOPT Version :9

Sequence 1:NP_649245.1 Gene:CG13250 / 40284 FlyBaseID:FBgn0037013 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster


Alignment Length:182 Identity:33/182 - (18%)
Similarity:54/182 - (29%) Gaps:53/182 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VVPILW------QPSLATRDFDIRWRDINCSVIDPTTAEIFKCDIVEMPKKQ------GNFLNTF 69
            :|.::|      ||.........:..:..|...:.:..|...|.:..:.:.:      .|.|:..
  Fly     3 IVLVIWMLAHSLQPPYQCDAVIFKMTNAVCETYNKSWVEFGLCRLRAVSRNKVCLNVDANLLHPV 67

  Fly    70 --------LLLRRSVTKMWVELSVGQIANRKDRPVQQLFKIRVDGCHLIEFRSKSRILNAVLHKL 126
                    ||.|.:..|.|                  |:.:..|||..|. |..:.::..|....
  Fly    68 HDVIVKARLLKRANGYKPW------------------LYSVSFDGCQFIR-RRNNALIRIVWELF 113

  Fly   127 LQSGNYPDACPL--LANVNYTSTRFALNPDHFPAYMP--------DMKFNTK 168
            .:.......||.  |..|.    .|.|..:..|..:|        |..||.|
  Fly   114 KEYSTINHTCPYVGLQQVK----NFYLRSEKLPTPIPTGEYLLMIDWVFNKK 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13250NP_649245.1 DM8 95..181 CDD:214778 19/84 (23%)
CG14518NP_651653.2 DM8 83..173 CDD:214778 21/102 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472657
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.