DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13250 and CG33919

DIOPT Version :9

Sequence 1:NP_649245.1 Gene:CG13250 / 40284 FlyBaseID:FBgn0037013 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster


Alignment Length:162 Identity:32/162 - (19%)
Similarity:62/162 - (38%) Gaps:58/162 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 CCLVVPI---LWQPSLATRDFDIRWRDINCSVIDPTTAEIFKCDIVEMPKKQGNFLNTFLLLRRS 75
            |.::||:   :.:..:.|:|:..:::..   ::|   .:|..|:::|    :.||:...::    
  Fly    59 CFMIVPLHNPIIRMQVFTKDYSNQYKPF---LVD---VKIRICEVIE----RRNFIPYGVI---- 109

  Fly    76 VTKMWVELSVGQIANRKDRPVQQLFKIRVD---GC----HLIEFRSKSRILNAVLHKLLQSGNYP 133
               ||                 :|||...:   .|    |||   ::...|:..|......|.| 
  Fly   110 ---MW-----------------KLFKRYTNVNHSCPFSGHLI---ARDGFLDTSLLPPFPQGFY- 150

  Fly   134 DACPLLANVNYTSTRFALNPDHFPAYMPDMKF 165
            ....::.:.|.|||          .|:..|||
  Fly   151 QVSLVVTDTNSTST----------DYVGTMKF 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13250NP_649245.1 DM8 95..181 CDD:214778 19/78 (24%)
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 21/119 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472662
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.