DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13250 and CG33769

DIOPT Version :9

Sequence 1:NP_649245.1 Gene:CG13250 / 40284 FlyBaseID:FBgn0037013 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001027143.1 Gene:CG33769 / 3772499 FlyBaseID:FBgn0053769 Length:179 Species:Drosophila melanogaster


Alignment Length:188 Identity:39/188 - (20%)
Similarity:81/188 - (43%) Gaps:34/188 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ILCCLVVPILWQ---PSLATRDFDIRWRDINCSVIDPTTAEIFKCDIV-EM----PKKQGNFLNT 68
            :|.|:||.::.:   |.:..|..|..:   |.|.....:.:|.|..:: :|    ..:||  |..
  Fly    10 VLGCVVVTVVIKQSGPRMTFRAGDCTY---NRSTFSNFSIQIIKTKVIMDMILVTTLRQG--LKA 69

  Fly    69 FLLLRRSVTKMWVELSVGQIANRKDRPVQQLFKIRVDGCHLIEFRSKSRILNAVLHKLLQSGNYP 133
            .|.....:||.              :|.|.:::..::.|.||: .|:..|.......:|:.||:.
  Fly    70 HLSFEFRLTKA--------------KPYQSVYQHDMNYCALIK-GSQESIYRRWFTSMLKVGNFA 119

  Fly   134 DACPLLANVNYTSTRFALNPDHFPA--YMPDMKFNTKLVF-QLSRNM--GLIRASVDA 186
            .:||:.....|.. .:.|:.::.|:  |:.|.:.:....: :..:::  .|:..||:|
  Fly   120 TSCPIREGYYYLH-GWTLDANNVPSFLYLGDYRISGSFYYGRFKKHLYNPLLECSVEA 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13250NP_649245.1 DM8 95..181 CDD:214778 18/90 (20%)
CG33769NP_001027143.1 DM8 82..173 CDD:214778 18/92 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448048
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.