DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13250 and CG33766

DIOPT Version :9

Sequence 1:NP_649245.1 Gene:CG13250 / 40284 FlyBaseID:FBgn0037013 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001027140.1 Gene:CG33766 / 3772380 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster


Alignment Length:193 Identity:38/193 - (19%)
Similarity:68/193 - (35%) Gaps:62/193 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ILCCLVVPILWQPSLATRDFDIRWRDINCSVIDPTTAEIFKCDIVEMPKKQGNFLNT-------- 68
            ::|.::|||                        ||.      .|:.:..:.|||..:        
  Fly    12 LICLIIVPI------------------------PTN------KILLLESQCGNFNRSYFSNFTMF 46

  Fly    69 ---------FLLLRRSVTKMWVELSVGQIANRKDRPVQQLFKIRVDGCHLIEFRSKSRILNAVLH 124
                     |.|||..|..:.:::.. .|:.:.....|::|:..:|.|.|:..| ::.:......
  Fly    47 VKNSQMNMEFFLLRVLVPGVTMDIEF-FISMQNSYGFQKIFQYTLDMCSLLAQR-RNNMFKKWFA 109

  Fly   125 KLLQSGNYPDACPL------LANVNYTSTRFALNPDHFPAYMPDMKFNTKLVFQLSRNMGLIR 181
            ....|||:...||:      |.|.|| :|.|      .|.::...|:..|......|.:..:|
  Fly   110 TFFDSGNFKKYCPVEPNFYYLKNYNY-NTLF------IPKFLYAGKYRVKFDMNQLRKIDGVR 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13250NP_649245.1 DM8 95..181 CDD:214778 21/91 (23%)
CG33766NP_001027140.1 DUF1091 68..151 CDD:284008 20/91 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447848
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.