DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13250 and CG33767

DIOPT Version :9

Sequence 1:NP_649245.1 Gene:CG13250 / 40284 FlyBaseID:FBgn0037013 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001027141.1 Gene:CG33767 / 3772047 FlyBaseID:FBgn0053767 Length:188 Species:Drosophila melanogaster


Alignment Length:150 Identity:35/150 - (23%)
Similarity:60/150 - (40%) Gaps:14/150 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LILCCLVVPILWQPSLATRDFDIRWRDINCSVIDPTTAEIFKCDIVEMPKKQGNFLNTFLLLRRS 75
            ::..|.:|.|::...||...      ....|...||..|.|..:|      |.|.|...:...:.
  Fly    17 MLKVCTLVSIIFVHKLAITG------AAGKSNFSPTYFENFTLEI------QNNTLFMDMTTSKP 69

  Fly    76 VTKMWVELSVGQIANRKDRPVQQLFKIRVDGCHLIEFRSKSRILNAVLHKLLQSGNYPDACPLLA 140
            :.:....|...||:..|.|..|:||...:|.|.::. ..:..:..:....:|:.||:...||:.|
  Fly    70 IHRGLKVLLNTQISLDKGRSYQRLFAHILDTCGVVS-SVRGNLFKSWFDSMLKHGNFMVNCPVPA 133

  Fly   141 NVNYTSTRFALNPDHFPAYM 160
            . :|....:.|:....|.||
  Fly   134 G-HYFLRDWKLDSHLVPHYM 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13250NP_649245.1 DM8 95..181 CDD:214778 15/65 (23%)
CG33767NP_001027141.1 DM8 90..180 CDD:214778 15/64 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447968
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.