DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13250 and CG33643

DIOPT Version :9

Sequence 1:NP_649245.1 Gene:CG13250 / 40284 FlyBaseID:FBgn0037013 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001027258.1 Gene:CG33643 / 3772011 FlyBaseID:FBgn0053643 Length:178 Species:Drosophila melanogaster


Alignment Length:187 Identity:53/187 - (28%)
Similarity:83/187 - (44%) Gaps:18/187 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLILCCLVVPILWQPSLATRDFDIRWRDINCSVIDPTTAEIFKCDIVEMPKKQGNFLNTFLLLRR 74
            |..|.|.:  ||:....|.|:|.|....|:..:.|..|.|...|.:.:...:  :::|..:||.|
  Fly     4 LFWLYCFL--ILYCVDSAQRNFRIVVDHISTKIFDTKTIETLGCQVDQSSNR--SYVNCHMLLNR 64

  Fly    75 SVTKMWVELSVGQIANRKD--RPVQQ---LFKIRVDGCHLIEFRSKSRILNAVLHKLLQSGNYPD 134
            .|.|.       ...|..|  ||..|   |::.|:|.|.|:....|:|::|.......:..|.  
  Fly    65 EVGKF-------DARNVLDFVRPNGQEMKLYEGRLDACLLLGSIQKNRLVNIYSKTFKRFSNV-- 120

  Fly   135 ACPLLANVNYTSTRFALNPDHFPAYMPDMKFNTKLVFQLSRNMGLIRASVDAEVMRR 191
            .|||.||.|||.....::...||:::|...|.:.:.|.|::.....||....:||.|
  Fly   121 ECPLKANFNYTMKNLYMDEQDFPSFVPSGTFRSLIEFYLNQTFIASRAIARGKVMPR 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13250NP_649245.1 DM8 95..181 CDD:214778 25/88 (28%)
CG33643NP_001027258.1 DUF1091 75..152 CDD:284008 24/78 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FA0X
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.