DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13250 and CG33783

DIOPT Version :9

Sequence 1:NP_649245.1 Gene:CG13250 / 40284 FlyBaseID:FBgn0037013 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001027168.1 Gene:CG33783 / 3771958 FlyBaseID:FBgn0053783 Length:164 Species:Drosophila melanogaster


Alignment Length:165 Identity:32/165 - (19%)
Similarity:61/165 - (36%) Gaps:33/165 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DINCSVIDPTTAEIFKCDIVEMPKKQGNFLNTFLLLRRSVTKMWVELSVGQIANRKD-------- 93
            :|.|:..:.:..|:.:|::              .:|.|.:..:::.....|:.....        
  Fly    12 NIKCTCYEKSFCELKRCEL--------------KVLGRGIVGLFLHAQAHQLPINSSTCILSLYR 62

  Fly    94 -----RPVQQLFKIRVDGCHLIEFRSKSRILNAVLHKLLQSGNYPDACPLLANVNYTSTRFALNP 153
                 ||.  |:.:.||.|...:.|.:...::.|...:....|...:||  .|.:....|..|| 
  Fly    63 RFNGYRPF--LYNMTVDICSFFKNRKRYPFVDLVYDAIKNFSNVNHSCP--HNHDIIVNRMVLN- 122

  Fly   154 DHFPAYMPDMKFNTKLVFQLSRNMGLIRASVDAEV 188
            |:....:|......||:|.|..: |:.|..|:..|
  Fly   123 DNMIVKVPFPSGFYKLMFILKTD-GIWRGEVEVYV 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13250NP_649245.1 DM8 95..181 CDD:214778 21/85 (25%)
CG33783NP_001027168.1 DUF1091 60..138 CDD:284008 17/82 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472647
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.