DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13250 and CG33927

DIOPT Version :9

Sequence 1:NP_649245.1 Gene:CG13250 / 40284 FlyBaseID:FBgn0037013 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001027147.1 Gene:CG33927 / 3771851 FlyBaseID:FBgn0053927 Length:182 Species:Drosophila melanogaster


Alignment Length:145 Identity:29/145 - (20%)
Similarity:65/145 - (44%) Gaps:17/145 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 CSVIDPTTAEIFKCDIVEMPKKQG----NFLNTFLLLRRSVTKMWVELSVGQIANRKDRPVQQLF 100
            |..::.|...:.:|.:..:  ::|    :|..|.|   ::::|..|.   |||..|.:.....|:
  Fly    35 CDSVNETWLAVHQCRLKAI--RRGTTTLSFNGTVL---KTISKFRVH---GQIFKRANGFKPWLY 91

  Fly   101 KIRVDGCHLIEFRSKSRILNAVLHKLLQS-GNYPDACPLLANVNYTSTRFALNPDHFPAYMPDMK 164
            .|..|||..:....::.::  ::..||:| .|....||.:..|:.....  :..:..|..:|..:
  Fly    92 NITFDGCRFLRKPYEAPVI--IVFNLLKSFSNLNFTCPYMGPVHIMGLH--IIGEQIPVPLPTGE 152

  Fly   165 FNTKLVFQLSRNMGL 179
            :..::.:.:|:.:.|
  Fly   153 YLIQIKWYISKTLFL 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13250NP_649245.1 DM8 95..181 CDD:214778 16/86 (19%)
CG33927NP_001027147.1 DUF1091 75..155 CDD:284008 19/86 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472642
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.