DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13250 and CG13193

DIOPT Version :10

Sequence 1:NP_649245.1 Gene:CG13250 / 40284 FlyBaseID:FBgn0037013 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_610699.1 Gene:CG13193 / 36256 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster


Alignment Length:152 Identity:37/152 - (24%)
Similarity:59/152 - (38%) Gaps:15/152 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 WQPSLATRDFDIRWRDINCSVIDPTTAEIFKCDIVEMPK-----------KQGNFLNTFLLLRRS 75
            |.|.......|:....|:.....||....|....||..|           .:|. ||..:.|.|:
  Fly     8 WSPKSPQAHQDLIQIQISALRFGPTLRSKFTNISVECSKDYCSSIRGWLTAKGE-LNLDIHLNRT 71

  Fly    76 VTK-MWVELSVGQIANRKDRPVQQLFKIRVDGCHLIEFRSKSRILNAVLHKLLQSGNYPDACPLL 139
            :.. :...:::.|:.:.||| .|.||...:|.|..:....:|.::...|..:.:.||..|.|| :
  Fly    72 LKNGLRTTITLLQLIDGKDR-YQTLFSYDMDTCKTLRELLQSSLMKVWLRNVFKYGNLADRCP-I 134

  Fly   140 ANVNYTSTRFALNPDHFPAYMP 161
            ...:|....|.|.....|.|:|
  Fly   135 QPASYDVRNFQLENHSIPGYLP 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13250NP_649245.1 DM8 95..181 CDD:214778 18/67 (27%)
CG13193NP_610699.1 DM8 91..183 CDD:214778 19/68 (28%)

Return to query results.
Submit another query.