DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13250 and CG13193

DIOPT Version :9

Sequence 1:NP_649245.1 Gene:CG13250 / 40284 FlyBaseID:FBgn0037013 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_610699.1 Gene:CG13193 / 36256 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster


Alignment Length:152 Identity:37/152 - (24%)
Similarity:59/152 - (38%) Gaps:15/152 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 WQPSLATRDFDIRWRDINCSVIDPTTAEIFKCDIVEMPK-----------KQGNFLNTFLLLRRS 75
            |.|.......|:....|:.....||....|....||..|           .:|. ||..:.|.|:
  Fly     8 WSPKSPQAHQDLIQIQISALRFGPTLRSKFTNISVECSKDYCSSIRGWLTAKGE-LNLDIHLNRT 71

  Fly    76 VTK-MWVELSVGQIANRKDRPVQQLFKIRVDGCHLIEFRSKSRILNAVLHKLLQSGNYPDACPLL 139
            :.. :...:::.|:.:.||| .|.||...:|.|..:....:|.::...|..:.:.||..|.|| :
  Fly    72 LKNGLRTTITLLQLIDGKDR-YQTLFSYDMDTCKTLRELLQSSLMKVWLRNVFKYGNLADRCP-I 134

  Fly   140 ANVNYTSTRFALNPDHFPAYMP 161
            ...:|....|.|.....|.|:|
  Fly   135 QPASYDVRNFQLENHSIPGYLP 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13250NP_649245.1 DM8 95..181 CDD:214778 18/67 (27%)
CG13193NP_610699.1 DM8 91..183 CDD:214778 19/68 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447888
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.