DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13250 and CG33477

DIOPT Version :10

Sequence 1:NP_649245.1 Gene:CG13250 / 40284 FlyBaseID:FBgn0037013 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_995797.1 Gene:CG33477 / 2768726 FlyBaseID:FBgn0053477 Length:198 Species:Drosophila melanogaster


Alignment Length:210 Identity:41/210 - (19%)
Similarity:75/210 - (35%) Gaps:61/210 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LRGLL----------ILCCLVVPILW--QPSLATR---DFDIRWRDINCSVIDPTTAEIFKCDIV 56
            |.|||          ::|..:|..|.  ||....|   ::.:...|..|   |....|.|.    
  Fly    13 LFGLLFFVEEHEVISVICLNLVKYLTIPQPIAVQRGNAEYSLESLDTRC---DHDFVEYFH---- 70

  Fly    57 EMPKKQGNFLNTFLLLRRSVTKMWVELSVGQIANRKDRPVQQLFKI-RVDGCHLIEFRSKSRILN 120
            .:|  ....|.||.:::.: ....:.:::..:...:     .::|| ...||..:.        |
  Fly    71 RVP--DSKILYTFRVVKLA-PAFTINITIKVLKTHR-----IMYKIENFKGCEFLN--------N 119

  Fly   121 AVLHK--------LLQSGNYPDACPLLANVNYTSTRFALNPDHFPAYMPDMKFNTKL-------- 169
            .|:.|        |:.:|:| ..||:..||.|..|...::  ..|:..|..:|...:        
  Fly   120 PVIFKMFGESYKTLVVNGSY-FKCPIKPNVYYLKTDGIMS--MIPSVHPFGRFQLSMRVKMKESR 181

  Fly   170 ---VFQLSRNMGLIR 181
               |.::..|..::|
  Fly   182 KPFVMEMLLNYTIVR 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13250NP_649245.1 DM8 95..181 CDD:214778 21/105 (20%)
CG33477NP_995797.1 DUF1091 100..171 CDD:461928 19/86 (22%)

Return to query results.
Submit another query.