DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13250 and CG33477

DIOPT Version :9

Sequence 1:NP_649245.1 Gene:CG13250 / 40284 FlyBaseID:FBgn0037013 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_995797.1 Gene:CG33477 / 2768726 FlyBaseID:FBgn0053477 Length:198 Species:Drosophila melanogaster


Alignment Length:210 Identity:41/210 - (19%)
Similarity:75/210 - (35%) Gaps:61/210 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LRGLL----------ILCCLVVPILW--QPSLATR---DFDIRWRDINCSVIDPTTAEIFKCDIV 56
            |.|||          ::|..:|..|.  ||....|   ::.:...|..|   |....|.|.    
  Fly    13 LFGLLFFVEEHEVISVICLNLVKYLTIPQPIAVQRGNAEYSLESLDTRC---DHDFVEYFH---- 70

  Fly    57 EMPKKQGNFLNTFLLLRRSVTKMWVELSVGQIANRKDRPVQQLFKI-RVDGCHLIEFRSKSRILN 120
            .:|  ....|.||.:::.: ....:.:::..:...:     .::|| ...||..:.        |
  Fly    71 RVP--DSKILYTFRVVKLA-PAFTINITIKVLKTHR-----IMYKIENFKGCEFLN--------N 119

  Fly   121 AVLHK--------LLQSGNYPDACPLLANVNYTSTRFALNPDHFPAYMPDMKFNTKL-------- 169
            .|:.|        |:.:|:| ..||:..||.|..|...::  ..|:..|..:|...:        
  Fly   120 PVIFKMFGESYKTLVVNGSY-FKCPIKPNVYYLKTDGIMS--MIPSVHPFGRFQLSMRVKMKESR 181

  Fly   170 ---VFQLSRNMGLIR 181
               |.::..|..::|
  Fly   182 KPFVMEMLLNYTIVR 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13250NP_649245.1 DM8 95..181 CDD:214778 21/105 (20%)
CG33477NP_995797.1 DUF1091 100..171 CDD:284008 19/86 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.