DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rcd2 and crim1

DIOPT Version :10

Sequence 1:NP_649244.3 Gene:Rcd2 / 40283 FlyBaseID:FBgn0037012 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_997986.1 Gene:crim1 / 404210 ZFINID:ZDB-GENE-040312-2 Length:1027 Species:Danio rerio


Alignment Length:223 Identity:62/223 - (27%)
Similarity:82/223 - (36%) Gaps:74/223 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LQSCAMPIIDPDSIDESLACPP-----CEND----------------------------FPICYK 45
            |..| .|:...|.  .::.|||     |..|                            ||.|..
Zfish   238 LYEC-KPVFSVDC--STVECPPVKPVQCPADSYETQVRLTADGCCTLPTRCECLPGLCTFPQCSA 299

  Fly    46 VIVE--VERGNGLPGSCCPRYECLDE-EPVC--------DGSKRRFYKNKCTVCD---------- 89
            .:..  :.||:|.||.||..:||::| :|.|        ||.  .|..:.|..|.          
Zfish   300 GMSPQVMSRGDGTPGRCCDVFECVNETKPACTLNGVEYHDGD--MFRMDACRFCRCQGGVSVCFT 362

  Fly    90 ------PCEPLAIQCKEICPM-EEPEPICLS-----DNNEYHRNGDIWMENNGCTTCMCEGGYVT 142
                  .||...:...|.||: |:|....||     .|.:...:||.|.|:: ||.|.|..|...
Zfish   363 AQCGVLHCERYYVPDGECCPVCEDPIYPVLSLAGCYVNGQILAHGDHWREDD-CTFCQCVSGDAR 426

  Fly   143 RNAVQCNHYYRCNNPVEVKGQCCPVCPD 170
            ..|..|.|  .|.|||.|.|:|||||.:
Zfish   427 CVAAACGH--SCLNPVTVPGECCPVCEE 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rcd2NP_649244.3 VWC 114..168 CDD:214564 22/53 (42%)
crim1NP_997986.1 IGFBP 33..84 CDD:459717
Cell attachment site. /evidence=ECO:0000255 308..310 1/1 (100%)
VWC 330..384 CDD:214564 11/55 (20%)
VWC 397..450 CDD:450195 22/55 (40%)
Antistasin 506..526 CDD:460713
Antistasin 533..558 CDD:460713
Antistasin 561..586 CDD:460713
VWC 607..657 CDD:450195
VWC 678..729 CDD:450195
VWC 751..803 CDD:450195
VWC 812..866 CDD:450195
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 877..897
Cell attachment site. /evidence=ECO:0000255 883..885
CRIM1_C 898..1026 CDD:437274
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.