DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4858 and Nubpl

DIOPT Version :9

Sequence 1:NP_649243.1 Gene:CG4858 / 40282 FlyBaseID:FBgn0037011 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_084036.2 Gene:Nubpl / 76826 MGIID:1924076 Length:319 Species:Mus musculus


Alignment Length:261 Identity:98/261 - (37%)
Similarity:147/261 - (56%) Gaps:13/261 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LDKVKNVIVVLSGKGGVGKSTVSTQLSLALRKNGFK--VGLLDIDLCGPSVPYLLGLEGRDIFQC 64
            ::.|:.||||.||||||||||.:..|:|||..|...  |||||:|:.|||:|.::.|.|......
Mouse    63 IEGVREVIVVASGKGGVGKSTTAVNLALALAANDSSKAVGLLDVDVYGPSIPKMMNLRGNPELSP 127

  Fly    65 DDGWVPVYTDESQTLAVMSIGFLLKNREDPVIWRGPKKTMMIRQFLTDVRWDELDYLIIDTPPGT 129
            ::...|:.   :..:|.||:|||::... |::|||......|.:.|..|.|.:||||::|.||||
Mouse   128 NNLMRPLL---NYGIACMSMGFLVEETA-PLVWRGLMVMSAIEKLLRQVDWGQLDYLVVDMPPGT 188

  Fly   130 SDEHITVMECLKEVGCHGAIIVTTPQEVALDDVRKEITFCKKTGINILGIVENMSGFVCPHCTSC 194
            .|..::|.:   .:...||:||:|||::||.|..|.....:|..:.:||:|:|||.|.||.|...
Mouse   189 GDVQLSVSQ---NIPISGAVIVSTPQDIALMDAHKGAEMFRKVNVPVLGLVQNMSVFQCPKCKHK 250

  Fly   195 TNIFSSNGGVSLATYAQVPHLGTLPIDPRVGILAGTTTSVLDELPDSTTAEVLTHI----VEKLK 255
            |:||.::|...||....:..||.:|:...:...:.....|:...|.|..|:...||    |.:||
Mouse   251 THIFGADGARKLAQTLDLDVLGDVPLHLSIREASDMGQPVVFSQPGSDEAKAYLHIASEVVRRLK 315

  Fly   256 T 256
            :
Mouse   316 S 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4858NP_649243.1 ParA 4..254 CDD:287566 96/255 (38%)
minD_arch 8..254 CDD:131024 95/251 (38%)
NubplNP_084036.2 Mrp 17..284 CDD:223563 89/227 (39%)
ParA 65..311 CDD:287566 95/252 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53899
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100169
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.