DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4858 and CG3262

DIOPT Version :9

Sequence 1:NP_649243.1 Gene:CG4858 / 40282 FlyBaseID:FBgn0037011 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001260688.1 Gene:CG3262 / 35452 FlyBaseID:FBgn0032986 Length:293 Species:Drosophila melanogaster


Alignment Length:254 Identity:87/254 - (34%)
Similarity:136/254 - (53%) Gaps:12/254 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VKNVIVVLSGKGGVGKSTVSTQLSLALRKNGFKVGLLDIDLCGPSVPYLLGLEGRDIFQCDDGWV 69
            |:::|||.|||||||||||:...:.:|.|.|.:|||||.|:.||::|.|:.:.|..:....:..:
  Fly    38 VQDIIVVASGKGGVGKSTVAVNFACSLAKLGKRVGLLDGDIFGPTIPLLMNVHGEPVVNDKNLMI 102

  Fly    70 PVYTDESQTLAVMSIGFLLKNREDPVIWRGPKKTMMIRQFLTDVRWDELDYLIIDTPPGTSDEHI 134
            |   .::..:..:|:| :|...|..||||||.....|::.|....|..||.|:|||||||.|.|:
  Fly   103 P---PQNYNVKCLSMG-MLTPVETSVIWRGPLVMSAIQRLLKGTDWGLLDVLVIDTPPGTGDVHL 163

  Fly   135 TVMECLKEVGCHGAIIVTTPQEVALDDVRKEITFCKKTGINILGIVENMSGFVCPHCTSCTNIFS 199
            ::.:   .....|.|:||||...|:....|..:..:|..:.|.|:||||...:|.:|......|.
  Fly   164 SLSQ---HAPITGVILVTTPHTAAVQVTLKGASMYEKLNVPIFGVVENMKYTICQNCNQRLEFFK 225

  Fly   200 SNGGVSLATYAQVPHLGTLPIDPRVGILAGTTTSVLDELPDSTTAEVLTHIVEKLKTML 258
            .:...||..     .|.:||:|.|:.....:...|:.:.|||..:.:.|.:.|::..:|
  Fly   226 DSRISSLPR-----KLISLPLDSRIADSNESGVPVVIKYPDSKYSYLFTQLAEEITQIL 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4858NP_649243.1 ParA 4..254 CDD:287566 86/248 (35%)
minD_arch 8..254 CDD:131024 85/245 (35%)
CG3262NP_001260688.1 ParA 37..275 CDD:287566 86/248 (35%)
minD_arch 41..281 CDD:131024 86/251 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455524
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1166096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100169
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.650

Return to query results.
Submit another query.