DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4858 and nubp2

DIOPT Version :9

Sequence 1:NP_649243.1 Gene:CG4858 / 40282 FlyBaseID:FBgn0037011 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_012825448.1 Gene:nubp2 / 100125178 XenbaseID:XB-GENE-999229 Length:270 Species:Xenopus tropicalis


Alignment Length:256 Identity:138/256 - (53%)
Similarity:192/256 - (75%) Gaps:0/256 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LDKVKNVIVVLSGKGGVGKSTVSTQLSLALRKNGFKVGLLDIDLCGPSVPYLLGLEGRDIFQCDD 66
            |..|:::|:||||||||||||:||:::||||..|.|||:||:||||||:|.:|..:.:|:.|||.
 Frog    10 LSGVQHIILVLSGKGGVGKSTISTEIALALRHAGKKVGILDVDLCGPSIPRMLNAQSKDVHQCDS 74

  Fly    67 GWVPVYTDESQTLAVMSIGFLLKNREDPVIWRGPKKTMMIRQFLTDVRWDELDYLIIDTPPGTSD 131
            ||||||.|:.:::::|||||||::.:|.|:||||||..:|:||.:||.|.:||:||:||||||||
 Frog    75 GWVPVYVDQEKSISLMSIGFLLEHPDDAVVWRGPKKNALIKQFASDVAWGDLDFLIVDTPPGTSD 139

  Fly   132 EHITVMECLKEVGCHGAIIVTTPQEVALDDVRKEITFCKKTGINILGIVENMSGFVCPHCTSCTN 196
            |||..::.|:.....||::|||||.|::.|||:|:|||||||:.::||||||||:||||||.|||
 Frog   140 EHIATVDALRPFNPMGALLVTTPQAVSVGDVRRELTFCKKTGLRVIGIVENMSGYVCPHCTECTN 204

  Fly   197 IFSSNGGVSLATYAQVPHLGTLPIDPRVGILAGTTTSVLDELPDSTTAEVLTHIVEKLKTM 257
            |||..||..||..:.||.||.:|:||.:..........:.|.|:|.....::.|..::..|
 Frog   205 IFSKGGGEELARLSGVPFLGCVPLDPLLSQSLEQGKDFVQEFPNSAAYPAISSIARQILDM 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4858NP_649243.1 ParA 4..254 CDD:287566 136/249 (55%)
minD_arch 8..254 CDD:131024 135/245 (55%)
nubp2XP_012825448.1 ParA 12..263 CDD:378455 136/250 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 308 1.000 Domainoid score I1337
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8057
Inparanoid 1 1.050 309 1.000 Inparanoid score I2570
OMA 1 1.010 - - QHG53899
OrthoDB 1 1.010 - - D1166096at2759
OrthoFinder 1 1.000 - - FOG0001227
OrthoInspector 1 1.000 - - oto105433
Panther 1 1.100 - - LDO PTHR23264
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R189
SonicParanoid 1 1.000 - - X4074
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.