DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mTerf3 and Mterf1

DIOPT Version :9

Sequence 1:NP_649240.1 Gene:mTerf3 / 40279 FlyBaseID:FBgn0037008 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_445951.1 Gene:Mterf1 / 85261 RGDID:621318 Length:374 Species:Rattus norvegicus


Alignment Length:315 Identity:63/315 - (20%)
Similarity:108/315 - (34%) Gaps:102/315 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 NSSTLQQFLSLGVDLHSIERR---------------------KGLGDFVL--------------- 117
            |...|...|::|||:....||                     ||..|.|:               
  Rat    49 NGDLLNNLLTMGVDVDMARRRQPGVFNKAVTNEQELKMFLLSKGASDKVIGSIISRYPRAITRTP 113

  Fly   118 ------------------------------------KLDFEKNVKPYITFLVDQGVSPDDFGRMF 146
                                                .|:.|.|:|    ||...|::.....|:.
  Rat   114 ESLSKRWDLWREIMASDLEIVNILERSPESFFRSNNNLNLENNIK----FLCSVGLTHKCLCRLL 174

  Fly   147 TKNPLLFKEDLDDLQTRVNYLKSKRFS-------DEARQRILTQNPYWLMFSTRRVDRRLGYFQK 204
            |..|..|...|:..:..|.:|:....|       |..| :|:::||..|:.||:||...:.:.|.
  Rat   175 TSAPRTFSNSLNLNKQMVEFLQETGISLGHNNPTDFVR-KIISKNPSILIQSTKRVKTNIEFLQS 238

  Fly   205 EFKLSGHDLRLLATREPNA---------ITYNMEHLRKSVFTLKEEMGFNAKELSDLVVRKPRLL 260
            .|.|...||.||.. .|.|         ...|..:::|.:.:|    |...:|:...|:....::
  Rat   239 TFNLDKEDLLLLIC-GPGARILDLSNDCTKRNYTNIKKRLLSL----GCTEEEVQKFVLSYLNMI 298

  Fly   261 MIPPDDLVERFSYIHQDMGLPHAQIVQCPELLASREFRLRERHEFLKLLGRAQYD 315
            .:......::...:.::. :..:||::.|.:|.|....|:.|   ::.|..|.||
  Rat   299 FLSEKKFNDKIDCLLEEK-ISTSQILENPRVLDSSIHTLKTR---IRELAHAGYD 349

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
mTerf3NP_649240.1 mTERF <122..307 CDD:327630 46/200 (23%)
Mterf1NP_445951.1 mTERF 53..366 CDD:280667 62/311 (20%)