DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mTerf3 and AT1G79220

DIOPT Version :9

Sequence 1:NP_649240.1 Gene:mTerf3 / 40279 FlyBaseID:FBgn0037008 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_565202.1 Gene:AT1G79220 / 844263 AraportID:AT1G79220 Length:399 Species:Arabidopsis thaliana


Alignment Length:396 Identity:85/396 - (21%)
Similarity:145/396 - (36%) Gaps:94/396 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FCSALRNILRNSQNAAK-------NATITSQIRNLRGQQSVHHEVEVLTSPGITTKQNDKKTEPA 59
            |.:.:|.:..:|....|       :||.|::...|    .::...|.:....:::::  ||.:..
plant     9 FLAVIRLLFTSSSLVRKAGCRNLISATFTTRCSTL----CLNESEECIEDSDLSSRR--KKFDYV 67

  Fly    60 ECEGSKEVALDFRNREAHVPSFNLAAYVNNSSTLQQFLSLGVDLHSIER---------RKGLGDF 115
            ...|.||...|.                 .||.||.....|.|...|.:         |..:...
plant    68 GEVGEKEKVRDI-----------------TSSPLQVLRRWGCDDDEISKLFTRRPALQRANVAQL 115

  Fly   116 VLKLDFEK-------------NVKPYI---TFLVDQGV--------SPDDFGRMFTKNPLLFKED 156
            ..||...|             |.:|..   ..::|:.:        |.:...|:..:||.|...|
plant   116 EFKLSLLKPLGITSSDLVKILNCRPRFFSCRLVLDERINYFMEILGSKEVLRRVIIRNPSLMLYD 180

  Fly   157 LDD-LQTRVNYLKSKRFSDEARQRILTQNPYWLMFSTRRVDRRLGYFQKEFKLSGHDLRLLATRE 220
            ||| ::..:.|.|...||.:....:|...| .|:..|...:.:..|.:|    :|      .|||
plant   181 LDDKIKPAIEYYKGLGFSQQDLVAMLISRP-TLIPRTNFNNEKFEYIEK----TG------VTRE 234

  Fly   221 PNAITY--------NMEHLRKSVFTLKEEMGFNAKELSDLVVRKPRLLMIPPDDLVERFSYIHQD 277
            .....|        .||.:.:.|..| |:.||:.:|:..|..:.|.||.:..:.:....:::...
plant   235 SKMFKYVAVIIGVSRMETIEEKVRNL-EKFGFSEEEIWHLYGKCPILLSLSVEKVQRNMTFVIAS 298

  Fly   278 MGLPHAQIVQCP-ELLASREFRLRERHEFLKLLGRAQYDPQKDLYISPKTIVEGNNFYFVRNVAK 341
            |.||...:|:.| .||.:.|.||:.|.:.:|.:...:..|         .|.|.:.|..||...|
plant   299 MKLPAHSVVKHPCLLLLNLESRLKPRADLVKRVLEMRLKP---------LIKEVSIFRAVRMSEK 354

  Fly   342 SDLETF 347
            ..|:.:
plant   355 RFLKVY 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mTerf3NP_649240.1 mTERF <122..307 CDD:327630 51/218 (23%)
AT1G79220NP_565202.1 mTERF 84..357 CDD:418649 67/293 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1267
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto3830
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.