DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mTerf3 and AT1G74120

DIOPT Version :9

Sequence 1:NP_649240.1 Gene:mTerf3 / 40279 FlyBaseID:FBgn0037008 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_565080.1 Gene:AT1G74120 / 843752 AraportID:AT1G74120 Length:445 Species:Arabidopsis thaliana


Alignment Length:344 Identity:68/344 - (19%)
Similarity:126/344 - (36%) Gaps:79/344 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 NILRNS---------QNAAKNATITSQ-IRNLR--------GQQSVHHEVEVLTSPGITTKQNDK 54
            |:||:.         .|..|:..::|. |:::.        |....:..|.||.|.|.       
plant   102 NVLRSEFLRKWRVPLSNCGKHGVVSSSAIKSVLEHSSRIGIGPDKFNECVRVLKSLGF------- 159

  Fly    55 KTEPAECEGSKEVALDFRNREAHVPSFNLAAYVNNSSTLQQFLSLGVDLHSIERRKGLGDFVLKL 119
                  |:.:....|      :..|...|...:.....::..:.:|:...:|||...:...||.:
plant   160 ------CDSTVSRIL------SSFPGVLLVNEIEIRRKIEFLVGIGIARDNIERFFHVFPEVLGI 212

  Fly   120 DFEKNVKPYITFLVDQGVSPDDFGRMFTKNPLLFKEDLDDLQTRVNYLKSKRFSDEARQRILTQN 184
            ..|..:||.:...:..|.|.||..:...:.|.:...:|.:|...:..:.:.:..:..|..|:::.
plant   213 GTETRLKPLLDEFMKMGFSKDDVKKEIAREPRVLGLELGELPRCLELINTLKCREVIRVSIISEG 277

  Fly   185 PYWLMFSTR-RVDRRLGYFQKEFKLSGHDLRLLATREPNAITYNMEHLRKSVFTLKEEMGFNAKE 248
            .:...|..: |||....|     .|...|...:..:||..|.|.:|.:.|.:..|...|||:...
plant   278 AFRAGFEVKLRVDCLCKY-----GLIRRDAFKVVWKEPRVILYEIEDIEKKIEFLTNRMGFHINC 337

  Fly   249 LSDLVVRKPRLLMIP-PDDLVERFSYIHQ---------DMGL-----------------PHAQIV 286
            |:|:    |..|.:. ...:|.|::.|..         |:||                 |:.   
plant   338 LADV----PEYLGVNLQKQIVPRYNVIDYLKLKGGLGCDIGLKGLIKPSMKRFYNLYVMPYP--- 395

  Fly   287 QCPELLASRE--FRLRERH 303
            :|..:...|:  .|:.:||
plant   396 ECERIFGKRKENVRVNKRH 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mTerf3NP_649240.1 mTERF <122..307 CDD:327630 45/212 (21%)
AT1G74120NP_565080.1 mTERF 46..388 CDD:418649 62/313 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1267
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.