DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mTerf3 and AT1G62490

DIOPT Version :9

Sequence 1:NP_649240.1 Gene:mTerf3 / 40279 FlyBaseID:FBgn0037008 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_176438.1 Gene:AT1G62490 / 842546 AraportID:AT1G62490 Length:334 Species:Arabidopsis thaliana


Alignment Length:300 Identity:63/300 - (21%)
Similarity:109/300 - (36%) Gaps:85/300 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 GSKEVAL-DFRNREAHVPSFN--LAAYVNNSSTLQQFLSLGVDLHSIERRKGLGDFVLKLDFEKN 124
            |.:.:.| .:||....|....  .:|:.|:.||:   .|...|:..|:.:||           ||
plant    48 GRRSIELHKWRNFSVSVKLLQNVFSAFSNSFSTV---ASAAADVSLIDSQKG-----------KN 98

  Fly   125 VKPYITFLVDQ-GVSPDDFGRMFTKNPLLFKEDLDDLQTRVNYLKSKRFSDEARQRILTQNPYWL 188
            ..  :::|||. |:            |....|.:.         |..||.|:|       ||   
plant    99 FT--VSYLVDSLGL------------PKKLAESIS---------KKFRFEDKA-------NP--- 130

  Fly   189 MFSTRRVDRRLGYFQKEFKLSGHDLRLLATREPNAITYNMEHLRKSVFTLKEEMGFNAKELSDLV 253
             .|...:.|..|:...:..:.    :||..|....::...:.:::|   |:.:.....:.|..  
plant   131 -DSVLSLLRSHGFTVSQISIP----KLLGKRGHKTLSLYYDFVKES---LEADKSSKYETLCQ-- 185

  Fly   254 VRKPRLLMIPPDDL--VERFSYIHQDMGLPHAQIVQCPELLASREFRLRERHEF---LKLLGRAQ 313
                   ..|..:|  .:|...:.:::|:||..:.   .||.|....:..:..|   ||.:....
plant   186 -------SFPQGNLENKKRNVSVLRELGMPHKLLF---PLLISVGQPVCGKDRFNTSLKKVVEMG 240

  Fly   314 YDPQ-----KDLYIS----PKTIVEGNNFYFVRNVAKSDL 344
            :||.     |.|::|    .|||.|..|.|.:...|..|:
plant   241 FDPTTAKFVKALHVSYEMNDKTIEEKVNVYKMLGFAVEDV 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mTerf3NP_649240.1 mTERF <122..307 CDD:327630 34/190 (18%)
AT1G62490NP_176438.1 mTERF 134..>310 CDD:303004 33/165 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1267
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.